powered by:
Protein Alignment CG6610 and CG9344
DIOPT Version :9
Sequence 1: | NP_001261461.1 |
Gene: | CG6610 / 38693 |
FlyBaseID: | FBgn0035675 |
Length: | 91 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_611528.1 |
Gene: | CG9344 / 37372 |
FlyBaseID: | FBgn0034564 |
Length: | 79 |
Species: | Drosophila melanogaster |
Alignment Length: | 64 |
Identity: | 15/64 - (23%) |
Similarity: | 30/64 - (46%) |
Gaps: | 3/64 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 ELVDKCIGSRIHIIMKNDKEMVGTLLGFDDFVNMLLDDVTEYENTPDGRRITKLDQILLNGNNI 80
:.:::..|..:.:.:.|..:..|.|...|.::|:.|:...||.| |:...|.....:.|||:
Fly 9 QFINQIHGRPVAVKLNNGVDYRGVLACLDGYMNICLEQTEEYVN---GQLKNKYGDAFIRGNNV 69
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG6610 | NP_001261461.1 |
LSm5 |
12..87 |
CDD:212479 |
15/64 (23%) |
CG9344 | NP_611528.1 |
LSm6 |
8..73 |
CDD:212473 |
15/64 (23%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1958 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.