DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6610 and Sbat

DIOPT Version :9

Sequence 1:NP_001261461.1 Gene:CG6610 / 38693 FlyBaseID:FBgn0035675 Length:91 Species:Drosophila melanogaster
Sequence 2:NP_001259971.1 Gene:Sbat / 319043 FlyBaseID:FBgn0051950 Length:121 Species:Drosophila melanogaster


Alignment Length:90 Identity:21/90 - (23%)
Similarity:39/90 - (43%) Gaps:13/90 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PPPSNISTLMPLELVD-----------KCIGSRIHIIMKNDKEMVGTLLGFDDFVNMLLDDVTEY 58
            |.|..|:|..|.::.|           |.:|..:.|::.:.:.:||.....|...|::|....||
  Fly    20 PEPFRITTNAPHQMNDASLTPGRRKLQKWLGRVLRIVITDGRVLVGFFNCTDRDANIVLSMCAEY 84

  Fly    59 ENTPDGRRITKLDQILLNGNNITML 83
              ..:|:....|..:::.|.:|..|
  Fly    85 --LVEGQEPRLLGNVMVPGQHIVSL 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6610NP_001261461.1 LSm5 12..87 CDD:212479 18/83 (22%)
SbatNP_001259971.1 LSMD1 42..110 CDD:212486 15/68 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1958
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.