DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6610 and LSM5

DIOPT Version :9

Sequence 1:NP_001261461.1 Gene:CG6610 / 38693 FlyBaseID:FBgn0035675 Length:91 Species:Drosophila melanogaster
Sequence 2:NP_036454.1 Gene:LSM5 / 23658 HGNCID:17162 Length:91 Species:Homo sapiens


Alignment Length:81 Identity:69/81 - (85%)
Similarity:78/81 - (96%) Gaps:0/81 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SNISTLMPLELVDKCIGSRIHIIMKNDKEMVGTLLGFDDFVNMLLDDVTEYENTPDGRRITKLDQ 72
            :|.|.|:|||||||||||||||:||:|||:|||||||||||||:|:||||:|.||:|||||||||
Human     7 TNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQ 71

  Fly    73 ILLNGNNITMLVPGGE 88
            ||||||||||||||||
Human    72 ILLNGNNITMLVPGGE 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6610NP_001261461.1 LSm5 12..87 CDD:212479 64/74 (86%)
LSM5NP_036454.1 LSm5 11..86 CDD:212479 64/74 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159818
Domainoid 1 1.000 127 1.000 Domainoid score I5387
eggNOG 1 0.900 - - E1_COG1958
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40833
Inparanoid 1 1.050 145 1.000 Inparanoid score I4441
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54836
OrthoDB 1 1.010 - - D1558822at2759
OrthoFinder 1 1.000 - - FOG0005804
OrthoInspector 1 1.000 - - oto90239
orthoMCL 1 0.900 - - OOG6_103447
Panther 1 1.100 - - LDO PTHR20971
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3519
SonicParanoid 1 1.000 - - X4194
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.