DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42269 and CG31103

DIOPT Version :9

Sequence 1:NP_648019.2 Gene:CG42269 / 38689 FlyBaseID:FBgn0259164 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001097914.1 Gene:CG31103 / 43030 FlyBaseID:FBgn0051103 Length:506 Species:Drosophila melanogaster


Alignment Length:426 Identity:88/426 - (20%)
Similarity:165/426 - (38%) Gaps:112/426 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 TYAQSIFFLGAIVGGL-----LFGWVADRFGRIPALIGTNMMGLLAGVGTAFVSNFWEFAIMRFF 264
            |.|:....:.|.|.|:     ::|:::|..||...|:..|...........||::.|.|.|:...
  Fly    65 TQAEKGVMMAASVTGIFLSTYIWGYISDDIGRRRVLLYGNFASNALQFVLMFVTSVWLFNIINLL 129

  Fly   265 VGFAFDNCFTMMYILVLEYVGPKYRTFVANMSIAIFFTGAACLLP---WIA-----------YFL 315
            ||.:.......:|..:.|:..|::|....|.| .:|.:..|..:|   |:.           :..
  Fly   130 VGISVGAVSAALYAYLSEFNIPRHRAVAINYS-TMFVSVTAIYVPATAWLVLSSNWAITMGDFVF 193

  Fly   316 ADWKLLAIVTSAPLLLAIFTPFVVPESARWLVSQGKVDKAVGILKKLEKGN-GRQVPPQTYQIFT 379
            ..|:||.:|:..|..:........|||.::|:||.|.::|:..:..:.|.| |:.:    .|:. 
  Fly   194 RPWRLLLLVSLLPGFIGGLILLYYPESPKFLLSQEKNNEAIEAVAWISKFNRGKSI----QQVL- 253

  Fly   380 DSCK----RMQEQEAQN--GK-----------YSVLDLFKSPRLRRTTLLLIVIWMAISLVFDGH 427
             ||.    :.::...:|  |:           .:.:.||..|.    ....|:..:|:..:|   
  Fly   254 -SCDEFTLKSEDPVGENLLGESQGCGILSKICRATIPLFHKPH----GFNFILCNLALFGMF--- 310

  Fly   428 VRNVGSLGLDIFF------------------------------TFTLACFTELPADTLLT----- 457
               ..|.|:.::|                              |.||.|...:.:.|.:.     
  Fly   311 ---FSSNGMQLWFPEIVNRSSGAENNSSTVCEILSVPVEQPNVTETLDCTDPISSKTYIDNLVVG 372

  Fly   458 -----------VILDRFGRRWLACSSM---VLSGVFSLLATVVPVGI---YSAALAIMGRFFVNI 505
                       :||:..||:.:..:::   .||||. |.....|.|:   :...:.:.|   ::|
  Fly   373 FAFLIGFSIQGLILNPLGRKNVLLAALAVATLSGVL-LHFMESPTGVLVLFCLYILLPG---LSI 433

  Fly   506 SYNIGLQWAAEVLPTVVRAQAVAFIHIMGYVASIIA 541
            |..||.  ..:::||.:|::||:|...:|.:..|.|
  Fly   434 SIMIGA--IVDLVPTHLRSKAVSFCMSLGRLGIIAA 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42269NP_648019.2 2A0119 80..552 CDD:273328 88/426 (21%)
MFS 206..545 CDD:119392 87/425 (20%)
CG31103NP_001097914.1 2A0115 29..475 CDD:273327 88/426 (21%)
MFS 34..>189 CDD:119392 28/124 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458267
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.