DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42269 and T22F7.1

DIOPT Version :9

Sequence 1:NP_648019.2 Gene:CG42269 / 38689 FlyBaseID:FBgn0259164 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_497209.1 Gene:T22F7.1 / 3564822 WormBaseID:WBGene00020701 Length:510 Species:Caenorhabditis elegans


Alignment Length:434 Identity:103/434 - (23%)
Similarity:182/434 - (41%) Gaps:79/434 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 YATVATEQN-----WVCDDAALPTYAQSIFFLGAIVGGLLFGWVADRFGRIPALIGTNMM-GLLA 245
            :.|:..|.|     ::.:.|.|.|   ||:|||.::.|.||..|||||||.|.:|...:: |::.
 Worm   110 FYTIQNEFNLTSKFFLVEPAELTT---SIYFLGNLLIGQLFAVVADRFGRRPIIIICLLLTGIVG 171

  Fly   246 GVGTAFVSNFWEFAIMRFFVGFAFDNCFTMMYILVLEYVGPKYRTFVANMSIAIFFTGAA----- 305
            .:| :...||....:.||..|..:....|:.|:|..|.:..:      :.|:...|.|.:     
 Worm   172 SLG-SLAPNFPLLLVARFIQGSCYTPLTTVNYVLSGESIPHR------SQSLTSIFFGVSWVCGY 229

  Fly   306 CLLPWIAYFLADWKLLAIVTSAP-LLLAIFTPFVVPESARWLVSQGKVDKAVGILKKLEKGNGRQ 369
            |.|..::.:...|:.|.:.|:.| :|:|:|....:|||..:               .:||.|.:.
 Worm   230 CFLAPLSVWFNTWRSLQLATALPNILVAVFLMGTLPESVGY---------------SIEKKNRKA 279

  Fly   370 VPPQTYQIFTDSCKR--------MQEQE---------AQNGKYSVLDLFK--------SPRLRRT 409
            |.....:....|||:        |::.|         .|| :.::.::.:        :.|:...
 Worm   280 VQKWIKRNELLSCKKLNYDLDMIMEKTEKIATSSSPTPQN-RLTIFEMIREILSDREITRRIIVE 343

  Fly   410 TLLLIVIWM---AISLVFDGHVRNVGSLGLDIFFTFTLACFTELPADTLLTVILDRFGRR--WLA 469
            |.|.|:.:|   |:||.    ..:||:  .|...:|..:...||||...:.:.|.|..||  ...
 Worm   344 TFLWILTFMTYCALSLT----STSVGN--SDPLVSFLFSGVVELPAYLFIPICLTRTKRRPTRFL 402

  Fly   470 CSSMVLSGVFSLLATVVPVGIYSAALAI--MGRFFVNISYNIGLQWAAEVLPTVVRAQAVAFIHI 532
            |.   .:|..:||.........|..|.|  :.:|..:..|.....:|||:.||..|:..:.....
 Worm   403 CH---FTGSMALLTMYFLSNDTSLHLIIWLVAKFCASCCYIFCFIYAAELFPTWCRSCCIGVCST 464

  Fly   533 MGYVASIIAPFVVYLANISQALPLIILGILGIIGGLLALLLPET 576
            ...:.:|:||.:..:.:.:.....::|..:|::...|.....||
 Worm   465 CCNIGAIVAPHIFLIDSAAPGAQFLVLAAVGLLCSGLTWCQQET 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42269NP_648019.2 2A0119 80..552 CDD:273328 98/408 (24%)
MFS 206..545 CDD:119392 92/377 (24%)
T22F7.1NP_497209.1 MFS_SLC22 101..505 CDD:340875 101/429 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163073
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57756
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000012
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.