DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42269 and CG15221

DIOPT Version :9

Sequence 1:NP_648019.2 Gene:CG42269 / 38689 FlyBaseID:FBgn0259164 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001096957.1 Gene:CG15221 / 32127 FlyBaseID:FBgn0030331 Length:545 Species:Drosophila melanogaster


Alignment Length:469 Identity:103/469 - (21%)
Similarity:180/469 - (38%) Gaps:113/469 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 CDDAALPTYAQ-----SIFFLGAIVGGLLFGWVADRFGRIPALIGTNMMGLLAGVGTAFVSNFWE 257
            ||  ..||..|     |..|||.::.....|::||.:||...|.....:..:..:.:||..|.|.
  Fly    77 CD--LQPTLNQQGILASAGFLGVVLSSHAMGFLADTWGRATTLRYALCISSVCSIVSAFSVNIWM 139

  Fly   258 FAIMRFFVGFAFDNCFTMMYILVLEYVGP----KYRTFVAN-MSIAIFFTGAAC--LLPW----- 310
            ..:.||..||........::.|..|:.|.    ::.|.::. :.:|:.|..|..  :||.     
  Fly   140 LIVFRFLTGFFISGGQACVFSLCGEFHGTGSRIRHVTLLSGFLCMAMIFAPAMAIGILPLRIETI 204

  Fly   311 -IAYFLADWKLLAIVTSAPLLLAIFTPFVVPESARWLVSQGKVDKAVGILKKLEKGN-GRQVPPQ 373
             :....:.|::|.:...:..|||:.....:||:.::|:.||:.|:::.:|:.:...| ||.  |.
  Fly   205 VLGMHFSSWRVLLLANVSIPLLALVGISALPETPKYLLVQGRGDESLEVLRSIFANNSGRD--PS 267

  Fly   374 TYQIFTDSCKRMQEQEAQNGKYSVLD-----------------LFKSPRLRRTTLLLIV------ 415
            .|.:        :|...::|..|:.|                 ||...||..|..:..:      
  Fly   268 EYPV--------KEVALESGGVSLSDVHGFLDAVRLVWHQTVPLFYRARLWHTLNICCIQFIIYF 324

  Fly   416 ----IWMAISLVFD--GHVRNVGSLGLDIFFTFTL---------ACFTELPADT----------- 454
                |:|....:.|  |......:|...:...|.:         :|..|:...|           
  Fly   325 LAQGIFMWFPTILDELGTRNGENTLLCTVLQGFNINSSSEDEASSCSVEVDTSTYQVMIIIAACF 389

  Fly   455 -----LLTVILDRFGRRWLACSSMVLSGVFSLLATVVPVGIYSAALAIMGRFFVNISYNIG---L 511
                 :...|:|..|::.|..:.|||    :::..|....:...||.::....|....|.|   .
  Fly   390 VVIYLIFAYIIDYMGKKNLLMAWMVL----TMICLVALHYVEQFALVVIALTVVMAIGNCGGLVS 450

  Fly   512 QWAAEVLPTVVRAQAVAFIHIMGYVASIIAPFVVYLANISQALPLIILGIL------GIIGGLLA 570
            ..|.|..||.:.|..:.||.::|.:.:::.      :|        |||.|      .|...|||
  Fly   451 TIAMEFYPTHINAMGMCFIMMVGRLGAVVG------SN--------ILGRLLFASCDPIFWALLA 501

  Fly   571 L-LLPETLNHVLPQ 583
            | :|..||.:.||:
  Fly   502 LVVLLCTLGYFLPE 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42269NP_648019.2 2A0119 80..552 CDD:273328 89/429 (21%)
MFS 206..545 CDD:119392 84/414 (20%)
CG15221NP_001096957.1 2A0115 36..488 CDD:273327 92/440 (21%)
MFS 51..488 CDD:119392 92/440 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458291
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.