DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42269 and CG31106

DIOPT Version :9

Sequence 1:NP_648019.2 Gene:CG42269 / 38689 FlyBaseID:FBgn0259164 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_733086.2 Gene:CG31106 / 318594 FlyBaseID:FBgn0051106 Length:513 Species:Drosophila melanogaster


Alignment Length:438 Identity:105/438 - (23%)
Similarity:175/438 - (39%) Gaps:87/438 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 YATVATEQNWVCD------DAALPTYAQSIFFLGAIVGGLLFGWVADRFGRIPALIGTNMMGLLA 245
            |.|:.::    ||      |.|:.:.|.   |:|.......:|:::|..||.|.||.|.:.|...
  Fly    62 YITIVSQ----CDFEMNSMDKAVMSAAS---FIGIFCSSYFWGYLSDTIGRRPVLIYTTIAGNFL 119

  Fly   246 GVGTAFVSNFWEFAIMRFFVGFAFDNCFTMMYILVLEYVGPKYRTFVANMSIAIFFTGAACL-LP 309
            .:.:..:.|:|.:..:||.|||......:..|..:.|:..|::|....|  .|..|.|.:.: :|
  Fly   120 SLCSTVIPNYWLYVFIRFGVGFFIAGASSTTYAYLGEFFTPRHRPIAIN--YASLFVGVSTVYVP 182

  Fly   310 ---WI------------AYFLADWKLLAIVTSAPLLLAIFTPFVVPESARWLVSQGKVDKA---- 355
               |:            .:.|..|:||.|....|.::.....:.:|||.:.|:|..|.::|    
  Fly   183 ATAWLILSMDWSVSITDGFSLRPWRLLTICYLLPGVVGTLMLWSLPESPKILMSLHKTEEAFAAV 247

  Fly   356 ----------------VGILKKLEKGNGRQVPPQTYQIFTDSCKRMQEQEAQNGKYSVLDLFKSP 404
                            |..||..:..||..:...:...|| :.|:|.::..             |
  Fly   248 DWIAVTNSGKHLHEFKVHKLKTEDNANGENILLISKSAFT-TIKKMWKETL-------------P 298

  Fly   405 RLRRTTLLLIVIWMAI--SLVFDGHVRNVGSLGLDIFFTFTLACFTELPADTLLTV--ILDRFGR 465
            .|||..||..||...|  .|.|       .|.|:.:::...........||..:||  ::|....
  Fly   299 LLRRPHLLNFVISCTIMCGLFF-------SSSGMGLWYPEIQNRLGSNAADDSMTVCQVIDASID 356

  Fly   466 RWLACSSMVLSGVFSLLATVVPVGIYSAALAIMGRFFVNISYN-IGLQWAAEVLPTVVRAQAVAF 529
            :..|.:|..:........:.:....|.:|| |:|...:.:..| ||.:.:..:..|:..|.|:|.
  Fly   357 QMQANASNKICDDHINTKSYIDTITYGSAL-IVGYILMGLVINTIGRKASISIGLTLAGACAIAL 420

  Fly   530 IHIMGYVASIIAPFVVYLANISQALPLIILGILGIIGGLLALLLPETL 577
            |.|...|| |:..|.:||     .||.:.:.||   .|.:..|:|..|
  Fly   421 IFIKDEVA-IVVCFCLYL-----VLPGLCVSIL---SGAVVDLVPTHL 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42269NP_648019.2 2A0119 80..552 CDD:273328 97/411 (24%)
MFS 206..545 CDD:119392 89/379 (23%)
CG31106NP_733086.2 2A0115 37..486 CDD:273327 105/438 (24%)
MFS 40..512 CDD:119392 105/438 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458255
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.