DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42269 and Sv2c

DIOPT Version :9

Sequence 1:NP_648019.2 Gene:CG42269 / 38689 FlyBaseID:FBgn0259164 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_113781.1 Gene:Sv2c / 29643 RGDID:619718 Length:727 Species:Rattus norvegicus


Alignment Length:668 Identity:129/668 - (19%)
Similarity:215/668 - (32%) Gaps:246/668 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 TNGEYNNCYMYDVNYTDILA--QGK----VMADPKWPQVK------------------------- 173
            |.|......:|:..|..|.:  |||    .:..||..:.|                         
  Rat    79 TEGHDEEDEIYEGEYQGIPSTNQGKDSIVSVGQPKGDEYKDRRELESERRADEEELAQQYELIIQ 143

  Fly   174 -CRHG---WSYNFT-------------EIPYATVATEQNWVCDDAALPT----YAQSIFFLGAIV 217
             |.||   |:..|.             .:.:...:.|     .|..:|.    :..||.:||.:|
  Rat   144 ECGHGRFQWALFFVLGMALMADGVEVFVVGFVLPSAE-----TDLCIPNSGSGWLGSIVYLGMMV 203

  Fly   218 GGLLFGWVADRFGRIPA-LIGTNMMGLLAGVGTAFVSNFWEFAIMRFFVGFAFDNCFTMMYILVL 281
            |...:|.:||:.||..: ||..::.|..|.: ::||..:..|.:.|...||........::....
  Rat   204 GAFFWGGLADKVGRKQSLLICMSVNGFFAFL-SSFVQGYGFFLLCRLLSGFGIGGAIPTVFSYFA 267

  Fly   282 EYVGPKYRTFVANMSIAIFFTGA--ACLLPWI-------------AYFLADWKLLAIVTSAPLLL 331
            |.:..:.|....:.....:..|.  |..:.|.             ||....|::..||.:.|.:.
  Rat   268 EVLAREKRGEHLSWLCMFWMIGGIYASAMAWAIIPHYGWSFSMGSAYQFHSWRVFVIVCALPCVS 332

  Fly   332 AIFTPFVVPESARWLVSQGKVDKAVGILKKLEKGNGRQVPPQTYQIFT-------DSCKRMQEQE 389
            ::.....:|||.|:|:..||.|:|..|||.:...|.| ...|..::||       .....:.|.|
  Rat   333 SVVALTFMPESPRFLLEVGKHDEAWMILKLIHDTNMR-ARGQPEKVFTVNKIKTPKQIDELIEIE 396

  Fly   390 AQNGKY-----------------SVLDLFKSPRLRRTTLLLIVIWMAISLVFDG----------H 427
            :..|.:                 :.:..|..| :|..|:.|.::|..:|..:.|          |
  Rat   397 SDTGTWYRRCFVRIRTELYGIWLTFMRCFNYP-VRENTIKLTIVWFTLSFGYYGLSVWFPDVIKH 460

  Fly   428 V---------RNVGS---------------------------LGLD------------------- 437
            :         |||..                           ||:.                   
  Rat   461 LQSDEYALLTRNVQKDKYANFSINFTMENQVHTGMEYDNGRFLGVKFKSVTFKDSVFKSCTFDDV 525

  Fly   438 --------------------------------------------------------IFFTFTLAC 446
                                                                    |:|...|..
  Rat   526 TSVNTYFKNCTFIDTLFENTDFEPYKFIDSEFQNCSFLHNKTGCQITFDDDYSAYWIYFVNFLGT 590

  Fly   447 FTELPADTLLTVILDRFGRRWLACSSMVLSGV---FSLLATVVPVGIYSAALAIMGRFFVNISYN 508
            ...||.:.:..:::||.||..:...||||||:   |....|...:.|....|           ||
  Rat   591 LAVLPGNIVSALLMDRIGRLTMLGGSMVLSGISCFFLWFGTSESMMIGMLCL-----------YN 644

  Fly   509 IGLQWAA---------EVLPTVVRAQAVAFIHIMGYVASIIAPFVV-YLANISQALPLIILGILG 563
             ||..:|         |:.||..||....|::.:...|:::...:. .|.:|::|:|:::...:.
  Rat   645 -GLTISAWNSLDVVTVELYPTDRRATGFGFLNALCKAAAVLGNLIFGSLVSITKAIPILLASTVL 708

  Fly   564 IIGGLLALLLPETLNHVL 581
            :.|||:.|.||:|...||
  Rat   709 VCGGLVGLRLPDTRTQVL 726

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42269NP_648019.2 2A0119 80..552 CDD:273328 118/637 (19%)
MFS 206..545 CDD:119392 97/511 (19%)
Sv2cNP_113781.1 synapt_SV2 1..727 CDD:130366 129/668 (19%)
Interaction with SYT1. /evidence=ECO:0000269|PubMed:15866046 1..57
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..120 11/40 (28%)
MFS 155..719 CDD:119392 109/583 (19%)
Pentapeptide_3 507..561 CDD:290309 0/53 (0%)
(Microbial infection) C.botulinum neurotoxin type A-binding. /evidence=ECO:0000269|PubMed:16543415, ECO:0000269|PubMed:27294781 529..566 0/36 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.