DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42269 and SLC22A24

DIOPT Version :9

Sequence 1:NP_648019.2 Gene:CG42269 / 38689 FlyBaseID:FBgn0259164 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001129978.2 Gene:SLC22A24 / 283238 HGNCID:28542 Length:552 Species:Homo sapiens


Alignment Length:585 Identity:160/585 - (27%)
Similarity:269/585 - (45%) Gaps:74/585 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 MDFDDILPLIGEFGRYQKLLFICMIPFSFFVAFVYFSQIFL---TLIPEQHWCHVPELDG----- 126
            |.||.:|..:|..||:|    ||:|.|......:.|..|.|   |.....|.|.||.||.     
Human     1 MGFDVLLDQVGGMGRFQ----ICLIAFFCITNILLFPNIVLENFTAFTPSHRCWVPLLDNDTVSD 61

  Fly   127 -----LDVEARLALSIPM-TNGEYNNCYMYDVNYTDILAQGKVMADPKWPQVK-CRHGWSYNFTE 184
                 |..:..|.:|||: :|.....|..:......:|.......:...|..: |..||.|:.:.
Human    62 NDTGTLSKDDLLRISIPLDSNLRPQKCQRFIHPQWQLLHLNGTFPNTNEPDTEPCVDGWVYDRSS 126

  Fly   185 IPYATVATEQNWVCDDAALPTYAQSIFFLGAIVGGLLFGWVADRFGR--IPALIGTNMMGLLAGV 247
            . .:|:.||.:.||:..:|.:..||:|..|:::|||::|.::||.||  |..|....:  .::..
Human   127 F-LSTIVTEWDLVCESQSLKSMVQSLFMAGSLLGGLIYGHLSDRVGRKIICKLCFLQL--AISNT 188

  Fly   248 GTAFVSNFWEFAIMRFFVGFAFDNCFTMMYILVLEYVGPKYRTFVANMSIAIFFTGAACLLPWIA 312
            ..||...|..:.|:||..||:........:||.||:..|:.|:....:.:..:..| ..||..:|
Human   189 CAAFAPTFLVYCILRFLAGFSTMTILGNTFILSLEWTLPRSRSMTIMVLLCSYSVG-QMLLGGLA 252

  Fly   313 YFLADWKLLAIVTSAPLLLAIFTPFVVPESARWLVSQGKVDKAVGILKKLEKGNGRQVPPQTY-- 375
            :.:.||.:|.:..|.|:::...:.:.:.||||||:...::|:.:..|:::...||::...:|.  
Human   253 FAIQDWHILQLTVSTPIIVLFLSSWKMVESARWLIINNQLDEGLKELRRVAHINGKKNTEETLTT 317

  Fly   376 QIFTDSCKRMQEQEAQNGKYSVLDLFKSPRLRRTTLLLIVIWMAISLVFDGHVRNVGSLGLDIFF 440
            ::...:.|:  |.:|...|.|:..||::|:||.....|..:..||::.|.|.:.|:..||.::..
Human   318 ELVRSTMKK--ELDAVRIKTSIFSLFRAPKLRMRVFGLCFVRFAITVPFYGLILNLQHLGSNVSL 380

  Fly   441 --------TFTLACFTELPADTLLTVILDRFGRRWLACSSMVL----SGVFSLLATVVP--VGIY 491
                    |||..|.      :|||  |:..|||    .|.:|    .|:|.|:.|.:|  :.|.
Human   381 FQILCGAVTFTARCV------SLLT--LNHMGRR----ISQILFTFPVGLFILVNTFLPQEMQIL 433

  Fly   492 SAALAIMGRFFVNISYNIGLQWAAEVLPTVVRAQAVAFIHIMGYVASIIAPFVVYLANISQALPL 556
            ...||.:|...|:.:.|.......|::||::|:.......:.|...:.:||.::.|...|..||.
Human   434 RVVLATLGIGSVSAASNSASVHHNELVPTILRSTVAGINAVSGRTGAALAPLLMTLMAYSPHLPW 498

  Fly   557 IILGILGIIGGLLALLLPETLNHVLPQTLSDGEEFGRGQSIWDFPCLAKQVDDDEDEKRNADVEE 621
            |..|:..|:...:.||||||.:..||.|:.|                   |::|..:.||...|:
Human   499 ISYGVFPILAVPVILLLPETRDLPLPNTIQD-------------------VENDRKDSRNIKQED 544

  Fly   622  621
            Human   545  544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42269NP_648019.2 2A0119 80..552 CDD:273328 135/504 (27%)
MFS 206..545 CDD:119392 97/356 (27%)
SLC22A24NP_001129978.2 MFS_OAT 109..516 CDD:340932 117/424 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153837
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57756
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000012
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X24
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.