DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42269 and CG33233

DIOPT Version :9

Sequence 1:NP_648019.2 Gene:CG42269 / 38689 FlyBaseID:FBgn0259164 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster


Alignment Length:571 Identity:115/571 - (20%)
Similarity:201/571 - (35%) Gaps:192/571 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 PSMDFDDILPLIGEFGRYQKLLFICMIPFSFFVAFVYFSQIFLTLIPEQHWCHVPELDGLDVEAR 132
            |:||.|..|..|| :|..|.::|:    .|||:                                
  Fly     2 PAMDVDTALLTIG-YGLGQVIIFM----VSFFI-------------------------------- 29

  Fly   133 LALSIPMTNGEYNNCYMYDVNYTDILAQGKVMADPKWPQVKCRHGWSYNFTEIPYATVATEQNWV 197
                           |||.|  |:.:..|                         |..|.|.    
  Fly    30 ---------------YMYSV--TESMTAG-------------------------YLVVLTS---- 48

  Fly   198 CDDAALP---TYAQSIFFLGAIVGGLLFGWVADRFGRIPALIGTNMMGLLA-GVGTAFVSNFWEF 258
            |:....|   |...:....|.:..||..|::|||:|| ..:|...::|.|: .|.:|.:.:.:..
  Fly    49 CEFDTSPKEKTLLANSLLGGMVASGLFIGFLADRYGR-KFVIRLALVGALSFSVISALMPDLYSL 112

  Fly   259 AIMRFFVGFAFDNCFTMMYILVLEYVGPKYRTFVA-----NMSIAIFFTG--AACLLP------- 309
            :::|..||.......::....:.|:...|:|....     :..:|:.:..  |..:||       
  Fly   113 SVIRIIVGTFLSAVASLQVGFLGEFHAIKWRPITVAICSQSQGLALIYCPLVAMAILPNNFNVDL 177

  Fly   310 WIAYFLADWKLLAIVTSAPLLLAIFTPFVVPESARWLVSQGKVDKAVGILKKLEKGNGRQVPPQT 374
            ..:|.|..|:.|.:....|..||:....:|||:..:|:|..:.|||:..||.:.:.|.::     
  Fly   178 SSSYNLRVWRFLMMFFMIPGWLALVGICLVPETPHFLMSVNRPDKALLALKWICRMNRKK----- 237

  Fly   375 YQIFTDSCKRMQEQEAQNGK---------YSVLDLFKSPRLRRTTLLLIVIWMAISLVFDGHVRN 430
               :.|....:.|:::....         |....||..|.:.:   ..|.:::...:.|.     
  Fly   238 ---WEDVDITLSEEKSSTNDQEGFWKTVWYEYKLLFSKPHVFK---FFICLFLIFGIFFT----- 291

  Fly   431 VGSLGLDIFF----------------------TF-------TLACFTELP-ADTLLTVILD--RF 463
              |:||.|:|                      ||       |....:|.| .:..:|.::|  .:
  Fly   292 --SIGLGIWFPVIRNMDNSGSNRLCDLVNNNPTFINHEADDTNGTDSESPKCNDEMTNLIDPVYY 354

  Fly   464 GRRWLACSSMVLSGVFSLLATVVPVGI---YSAALAIMGRFFVNISYNIGLQWAAEVLPTVVRAQ 525
            |..::.|         .:||:|:...:   |..||.|:....:.||.||..|      ||||   
  Fly   355 GFTYIGC---------FILASVLVHWMTRKYVIALHILISMILGISLNIMKQ------PTVV--- 401

  Fly   526 AVAFIHIMGYVASIIAPFVVYLANISQALPLIILG-------ILGIIGGLL 569
             :.|..:|..:..::.|....:  :...||:.:.|       .|...||:|
  Fly   402 -LIFFVLMMVLPGVLIPLATSV--LVDCLPVNLRGKALCMVRSLARFGGVL 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42269NP_648019.2 2A0119 80..552 CDD:273328 102/533 (19%)
MFS 206..545 CDD:119392 83/397 (21%)
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 106/550 (19%)
MFS 23..>208 CDD:119392 47/267 (18%)
MFS 354..>482 CDD:304372 28/117 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458231
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.