DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42269 and SLC22A9

DIOPT Version :9

Sequence 1:NP_648019.2 Gene:CG42269 / 38689 FlyBaseID:FBgn0259164 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_543142.2 Gene:SLC22A9 / 114571 HGNCID:16261 Length:553 Species:Homo sapiens


Alignment Length:557 Identity:149/557 - (26%)
Similarity:246/557 - (44%) Gaps:66/557 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 MDFDDILPLIGEFGRYQKLLFICMIPFSFFVAFVYFSQIFLTLIP-EQHWCHVPELD-------- 125
            |.|.|:|...|:..|:|.|..:.:..|:......:..:.|...|| .:.|.|:.:.|        
Human     1 MAFQDLLGHAGDLWRFQILQTVFLSIFAVATYLHFMLENFTAFIPGHRCWVHILDNDTVSDNDTG 65

  Fly   126 GLDVEARLALSIPM-TNGEYNNCYMYDVNYTDILAQGKVMADPKW---------PQVK------C 174
            .|..:|.|.:|||: :|.....|..:              ..|:|         |...      |
Human    66 ALSQDALLRISIPLDSNMRPEKCRRF--------------VHPQWQLLHLNGTFPNTSDADMEPC 116

  Fly   175 RHGWSYNFTEIPY-ATVATEQNWVCDDAALPTYAQSIFFLGAIVGGLLFGWVADRFGRIPALIGT 238
            ..||.|:  .|.: :|:.||.:.|||..:|.:.|:.:|..|.:|||:|.|.::|||||...|...
Human   117 VDGWVYD--RISFSSTIVTEWDLVCDSQSLTSVAKFVFMAGMMVGGILGGHLSDRFGRRFVLRWC 179

  Fly   239 NMMGLLAGVGTAFVSNFWEFAIMRFFVGFAFDNCFTMMYILVLEYVGPKYRTFVANMSIAIFFTG 303
            .:...:.|...|....|..:..:||..|.|..:..|...:|:.|:...:::..  .:::.:..:|
Human   180 YLQVAIVGTCAALAPTFLIYCSLRFLSGIAAMSLITNTIMLIAEWATHRFQAM--GITLGMCPSG 242

  Fly   304 AACL-LPWIAYFLADWKLLAIVTSAPLLLAIFTPFVVPESARWLVSQGKVDKAVGILKKLEKG-- 365
            .|.: |..:|:.:.||.:|.:|.|.|..:...|...:.||||||:...|.::.   ||:|.|.  
Human   243 IAFMTLAGLAFAIRDWHILQLVVSVPYFVIFLTSSWLLESARWLIINNKPEEG---LKELRKAAH 304

  Fly   366 -----NGRQVPPQTYQIFTDSCKRMQEQEAQNGKYSVLDLFKSPRLRRTTLLLIVIWMAISLVFD 425
                 |.|..  .|.:|...:.|: :.:.||..|.|:.::...|.:.:...||.....|..:.:.
Human   305 RSGMKNARDT--LTLEILKSTMKK-ELEAAQKKKPSLCEMLHMPNICKRISLLSFTRFANFMAYF 366

  Fly   426 GHVRNVGSLGLDIFFTFTLACFTELPADTLLTVILDRFGRRWLACSSMVLSGVFS--LLATV-VP 487
            |...:|..||.::|...||.....|.|:.:....|....||   .|.|:|..:.:  |||.: ||
Human   367 GLNLHVQHLGNNVFLLQTLFGAVILLANCVAPWALKYMNRR---ASQMLLMFLLAICLLAIIFVP 428

  Fly   488 VGIYS--AALAIMGRFFVNISYNIGLQWAAEVLPTVVRAQAVAFIHIMGYVASIIAPFVVYLANI 550
            ..:.:  ..||.:|.....::..:......||:||::||:|:........:|..:||.::.|:..
Human   429 QEMQTLREVLATLGLGASALANTLAFAHGNEVIPTIIRARAMGINATFANIAGALAPLMMILSVY 493

  Fly   551 SQALPLIILGILGIIGGLLALLLPETLNHVLPQTLSD 587
            |..||.||.|:...|.|...||||||.|..|..|:.|
Human   494 SPPLPWIIYGVFPFISGFAFLLLPETRNKPLFDTIQD 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42269NP_648019.2 2A0119 80..552 CDD:273328 127/510 (25%)
MFS 206..545 CDD:119392 92/351 (26%)
SLC22A9NP_543142.2 Sugar_tr 11..527 CDD:331684 143/542 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 528..553 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153773
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000012
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X24
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.