DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and Prss32

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_081496.2 Gene:Prss32 / 69814 MGIID:1917064 Length:334 Species:Mus musculus


Alignment Length:291 Identity:85/291 - (29%)
Similarity:134/291 - (46%) Gaps:50/291 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ATILGAQAVDWNSVKNLNIETPMPKVHGETLPSGRITGGQIAEPNQFPYQVGLLLYITGGAAWCG 76
            :|..|.:::|.:|            |.|....||||..||.|:..::|:||.:.   ..||..||
Mouse    31 STTTGRRSIDLDS------------VCGRPRTSGRIVSGQDAQLGRWPWQVSVR---ENGAHVCG 80

  Fly    77 GTIISDRWIITAAHCTD-----SLTTGVDVYLGAHDRTNAKEEGQQIIFVETKNVIVHEDWIA-E 135
            |::|::.|::|||||.:     |:.|.:...:.::...|..:|.:.:     ...|.|..:.| |
Mouse    81 GSLIAEDWVLTAAHCFNQGQSLSIYTVLLGTISSYPEDNEPKELRAV-----AQFIKHPSYSADE 140

  Fly   136 TITNDISLIKLPVPIEFNKYIQPAKLPVKSDSYSTYGGENAIASGWGKI-SDSATGATDILQYAT 199
            ..:.||:|::|..||.||.|:.|..||...|....  |.....:|||.| ::........||...
Mouse   141 HSSGDIALVQLASPISFNDYMLPVCLPKPGDPLDP--GTMCWVTGWGHIGTNQPLPPPFTLQELQ 203

  Fly   200 VPIMNNSGCSPWY-------------FGLVAASNICIKTTGGISTCNGDSGGPLVLDDGSNTL-I 250
            ||:::...|:.:|             .|::.|.    ...|....||||||||||.|.....: .
Mouse   204 VPLIDAETCNTYYQENSIPGTEPVILEGMLCAG----FQEGKKDACNGDSGGPLVCDINDVWIQA 264

  Fly   251 GATSFGIALGCEV-GWPGVFTRITYYLDWIE 280
            |..|:|  ..|.: ..|||:|.::.|:.||:
Mouse   265 GVVSWG--SDCALFKRPGVYTNVSVYISWIQ 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 75/254 (30%)
Tryp_SPc 47..282 CDD:238113 76/256 (30%)
Prss32NP_081496.2 Tryp_SPc 53..292 CDD:214473 75/254 (30%)
Tryp_SPc 54..295 CDD:238113 76/256 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.