DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and CG34409

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster


Alignment Length:336 Identity:82/336 - (24%)
Similarity:145/336 - (43%) Gaps:98/336 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GAQAVDWN-------SVKNLNIETPMPKVHGETLPS-------------------------GRIT 48
            |.:|:|.|       :.....:.||:     ||:|:                         .|:.
  Fly   192 GEEAIDSNIDQGPPLAPFTTTLATPI-----ETIPASLSTTTASMPPFAQENTQGCGINVESRLL 251

  Fly    49 GGQIAEPNQFPYQVGLLLYITGGAA----WCGGTIISDRWIITAAHCTDSLTTGVDVYLGAHDRT 109
            ||..|...|||: :..:.|....::    .|.|::||...|:|||||..:|.:.:::   :|.|.
  Fly   252 GGDQASAGQFPW-LTRIAYRNRSSSRISFRCSGSLISSNHIVTAAHCVVNLVSDLEL---SHVRL 312

  Fly   110 NAKEEGQQIIFVETKNVIVHEDWIAETITNDISLIKL--------PVPIEFNKYIQPAKLPVKSD 166
            .: ::|.....:|  .||||.::......|||:|:::        |:.:.||..|          
  Fly   313 GS-QDGATPFAIE--QVIVHPNYDQPKYANDIALLRINSTNGTFTPICLPFNGPI---------- 364

  Fly   167 SYSTYG----GENAIASGW--GKISDSA----TGATDILQYATVPIMNNSGCSPWYFGL------ 215
               |.|    |:..:|:||  |...:::    :.:|..:::..:||:|.:.|:..|..|      
  Fly   365 ---TLGNRLIGQIGVAAGWSIGSTENNSSMDPSNSTAGVRFIRLPIVNTTSCAIAYASLSENFQQ 426

  Fly   216 ---VAASNICIKTTGGISTCNGDSGGPLVLDDGSN---------TLIGATSFGIALGCEVGWPGV 268
               :..:::|.:.......|.||||||. :|||::         |:||..:||..|......|||
  Fly   427 PIVITPNHLCAQGMPMNDVCRGDSGGPF-MDDGTSGVFGTSGRYTIIGIVAFGPTLCGVTTIPGV 490

  Fly   269 FTRITYYLDWI 279
            :|.::.:.|||
  Fly   491 YTLVSSFSDWI 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 71/272 (26%)
Tryp_SPc 47..282 CDD:238113 72/273 (26%)
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 71/272 (26%)
Tryp_SPc 252..501 CDD:238113 70/269 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436291
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.