DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and PRSS8

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens


Alignment Length:254 Identity:85/254 - (33%)
Similarity:129/254 - (50%) Gaps:24/254 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PSGRITGGQIAEPNQFPYQVGLLLYITGGAAWCGGTIISDRWIITAAHC--TDSLTTGVDVYLGA 105
            |..|||||..|...|:|:||.:..   .|...|||:::|::|:::||||  ::......:|.|||
Human    41 PQARITGGSSAVAGQWPWQVSITY---EGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGA 102

  Fly   106 HDRTNAKEEGQQIIFVET-KNVIVHEDWIAETITNDISLIKLPVPIEFNKYIQPAKLPVKSDSYS 169
            |...:..|:.:    |.| |::|.|..::.|....||:|::|..||.|::||:|..||..:.|:.
Human   103 HQLDSYSEDAK----VSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYIRPICLPAANASFP 163

  Fly   170 TYGGENAIASGWGKISDSATGAT-DILQYATVPIMNNSGCSPWYF--------GLVAASNICI-K 224
              .|.:...:|||.::.|.:..| ..||...||:::...|:..|.        ..|....:|. .
Human   164 --NGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNCLYNIDAKPEEPHFVQEDMVCAGY 226

  Fly   225 TTGGISTCNGDSGGPLVLD-DGSNTLIGATSFGIALGCEVGWPGVFTRITYYLDWIEEK 282
            ..||...|.|||||||... :|...|.|..|:|.|.|.. ..|||:|..:.|..||:.|
Human   227 VEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGAR-NRPGVYTLASSYASWIQSK 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 81/246 (33%)
Tryp_SPc 47..282 CDD:238113 82/248 (33%)
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 81/246 (33%)
Tryp_SPc 45..284 CDD:238113 82/248 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.