DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and ela3l

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:XP_021331840.1 Gene:ela3l / 554107 ZFINID:ZDB-GENE-060710-2 Length:270 Species:Danio rerio


Alignment Length:288 Identity:103/288 - (35%)
Similarity:151/288 - (52%) Gaps:42/288 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLATILGAQAVDWNSVKNLNIETPMPKVHGETLPSGRITGGQIAEPNQFPYQVGLLLYITGGAA 73
            |:||::|.|.|.....          |.:  |.|.| |:..|:.|.|:.:|:||. |.|.:|.:.
Zfish     4 LILASVLIASAFGCGK----------PPI--EPLMS-RVVNGEEARPHSWPWQVS-LQYQSGSSF 54

  Fly    74 W--CGGTIISDRWIITAAHCTDSLTTGVDVYLGAHDRTNAKEEGQQIIFVETKNVIVHEDW--IA 134
            :  |||:||::.|::|||||..| .....|.:|.|| .:..|||.|.|  ..:.:||||.|  :.
Zfish    55 YHTCGGSIIAENWVMTAAHCISS-GRNYRVLVGKHD-LSVNEEGSQTI--SAQKIIVHEKWNSMF 115

  Fly   135 ETITNDISLIKLPVPIEFNKYIQ----PAKLPVKSDSYSTYGGENAIASGWGKISDSATGAT--D 193
            ..:.|||:||||..|:..:..||    ||...|..::|..|      .||||::|   ||..  |
Zfish   116 VALGNDIALIKLAEPVTLSDTIQLGCVPAPGDVLPNNYPCY------ISGWGRLS---TGGALPD 171

  Fly   194 ILQYATVPIMNNSGCS--PWYFGLVAASNICIKTTGGISTCNGDSGGPLVL--DDGSNTLIGATS 254
            .||.|.:|.::::.||  .|:...|..:.:|....|.::.|||||||||..  .||...:.|..|
Zfish   172 RLQQALMPAVDHATCSRFDWWGSSVKETMVCAGGDGVVAGCNGDSGGPLNCKNSDGIWEVHGIAS 236

  Fly   255 FGIALGCE-VGWPGVFTRITYYLDWIEE 281
            |...|||. :..|.||||::.:.||:::
Zfish   237 FVSGLGCNTIRKPTVFTRVSSFTDWVDK 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 92/247 (37%)
Tryp_SPc 47..282 CDD:238113 92/250 (37%)
ela3lXP_021331840.1 Tryp_SPc 29..265 CDD:238113 92/250 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.