DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and ctrb.3

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001017724.1 Gene:ctrb.3 / 550419 ZFINID:ZDB-GENE-050417-229 Length:265 Species:Danio rerio


Alignment Length:250 Identity:87/250 - (34%)
Similarity:136/250 - (54%) Gaps:18/250 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PKVHGETLPSGRITGGQIAEPNQFPYQVGLLLYITGGAAWCGGTIISDRWIITAAHCTDSLTTGV 99
            |.|.|    ..||..|:.|.|:.:|:||.|..:.  |..:|||::|::.|::|||||  |:.|..
Zfish    26 PVVSG----YARIVNGEEAVPHSWPWQVSLQDFT--GFHFCGGSLINEFWVVTAAHC--SVRTSH 82

  Fly   100 DVYLGAHD--RTNAKEEGQQIIFVETKNVIVHEDWIAETITNDISLIKLPVPIEFNKYIQPAKLP 162
            .|.||.|:  ::|.:|:.|.   ::...|..|..:.:.||.|||:|:||..|...|.::.|..|.
Zfish    83 RVILGEHNKGKSNTQEDIQT---MKVSKVFTHPQYNSNTIENDIALVKLTAPASLNAHVSPVCLA 144

  Fly   163 VKSDSYSTYGGENAIASGWGKISDSATGATDILQYATVPIMNNSGCSPWYFGLVAASNICIKTTG 227
            ..||::::  |...:.||||....:|....|.||...:|:::|..|...:...:..:.||....|
Zfish   145 EASDNFAS--GMTCVTSGWGVTRYNALFTPDELQQVALPLLSNEDCKNHWGSNIRDTMICAGAAG 207

  Fly   228 GISTCNGDSGGPLVLD-DGSNTLIGATSFGIALGCEVGWPGVFTRITYYLDWIEE 281
            . |:|.||||||||.. |...||:|..|:| :..|:...|||:.|:|...||:::
Zfish   208 A-SSCMGDSGGPLVCQKDNIWTLVGIVSWG-SSRCDPTMPGVYGRVTELRDWVDQ 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 83/235 (35%)
Tryp_SPc 47..282 CDD:238113 83/237 (35%)
ctrb.3NP_001017724.1 Tryp_SPc 33..258 CDD:214473 83/235 (35%)
Tryp_SPc 34..261 CDD:238113 83/237 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.