DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and Tpsab1

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_062195.2 Gene:Tpsab1 / 54271 RGDID:3066 Length:310 Species:Rattus norvegicus


Alignment Length:298 Identity:88/298 - (29%)
Similarity:133/298 - (44%) Gaps:53/298 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFACATVLLLATILGAQAVDWNSVKNLNIETPMPKVHGETLPSGRITGGQIAEPNQFPYQVGLL 65
            :|....|:.||::::.|                .|.:   .:|...|.|||.|..|::|:||.|.
  Rat    39 LKLLLLTLPLLSSLVHA----------------APSL---AMPREGIVGGQEASGNKWPWQVSLR 84

  Fly    66 LYITGGAAWCGGTIISDRWIITAAHC-----TDSLTTGVDV---YLGAHDRTNAKEEGQQIIFVE 122
            :..|....:|||::|..:|::|||||     .|.....|.:   ||..||.           .:.
  Rat    85 VNDTYWMHFCGGSLIHPQWVLTAAHCVGPNKADPNKLRVQLRKQYLYYHDH-----------LLT 138

  Fly   123 TKNVIVHEDWIAETITNDISLIKLPVPIEFNKYIQPAKLPVKSDSYSTYGGENAIASGWGKISDS 187
            ...:|.|.|:.......||:|:||..|:.....:....||..|:::.:  |.....:|||.|::.
  Rat   139 VSQIISHPDFYIAQDGADIALLKLTNPVNITSNVHTVSLPPASETFPS--GTLCWVTGWGNINND 201

  Fly   188 ATGATDI-LQYATVPIMNNSGCS-PWYFGLVAASNICI-------KTTGGISTCNGDSGGPLVLD 243
            .:..... |:...|||:.|..|. .::.||....|:.|       ....|..:|.||||||||..
  Rat   202 VSLPPPFPLEEVQVPIVENRLCDLKYHKGLNTGDNVHIVRDDMLCAGNEGHDSCQGDSGGPLVCK 266

  Fly   244 DGSNTL-IGATSFGIALGC-EVGWPGVFTRITYYLDWI 279
            .....| .|..|:|  .|| :...||::||:|||||||
  Rat   267 VEDTWLQAGVVSWG--EGCAQPNRPGIYTRVTYYLDWI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 79/251 (31%)
Tryp_SPc 47..282 CDD:238113 81/252 (32%)
Tpsab1NP_062195.2 Tryp_SPc 66..302 CDD:214473 79/250 (32%)
Tryp_SPc 66..302 CDD:238113 79/250 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.