DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and ctrb2

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001011477.1 Gene:ctrb2 / 496968 XenbaseID:XB-GENE-1002990 Length:263 Species:Xenopus tropicalis


Alignment Length:280 Identity:81/280 - (28%)
Similarity:143/280 - (51%) Gaps:27/280 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FACATVLLLATILGAQAVDWNSVKNLNIETPMPKVHGETLPSGRITGGQIAEPNQFPYQVGLLLY 67
            |..:.::|:.:..|.           .:....|.:.|    ..||..|:.|....:|:||.  |.
 Frog     5 FLLSCIVLIGSTYGC-----------GVPAIKPIISG----YARIVNGENAVSGSWPWQVS--LQ 52

  Fly    68 ITGGAAWCGGTIISDRWIITAAHCTDSLTTGVDVYLGAHDRTNAKEEGQQIIFVETKNVIVHEDW 132
            ...|..:|||:::::.|::|||||  .:||...|.||.:||:::.|..|.   :....|..|.::
 Frog    53 DRTGFHFCGGSLVNNLWVVTAAHC--GVTTSHRVILGEYDRSSSAEPIQT---MSISRVFKHPNY 112

  Fly   133 IAETITNDISLIKLPVPIEFNKYIQPAKLPVKSDSYSTYGGENAIASGWGKISDSATGATDILQY 197
            ...|:.|||:|:||.....||..:.|..:|..|:.:::  .|..|.:|||.:...:..:.:.||.
 Frog   113 NTNTMINDITLLKLSSTASFNSRVAPVCIPTSSEVFNS--PERCITTGWGYVDAYSKLSPNKLQQ 175

  Fly   198 ATVPIMNNSGCSPWYFGLVAASNICIKTTGGISTCNGDSGGPLV-LDDGSNTLIGATSFGIALGC 261
            .|:|:::|:.|..::...:.::.||...:|. |:|.|||||||| ..:|:..|.|..|:|.:. |
 Frog   176 VTLPLLSNTECQRYWGNKIHSTMICAGASGA-SSCMGDSGGPLVCARNGAWVLAGIVSWGSST-C 238

  Fly   262 EVGWPGVFTRITYYLDWIEE 281
            ....|||:.|::....|:::
 Frog   239 SPSSPGVYARVSTLRSWMDQ 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 75/233 (32%)
Tryp_SPc 47..282 CDD:238113 75/236 (32%)
ctrb2NP_001011477.1 Tryp_SPc 34..259 CDD:238113 75/236 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.