DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and ctrl

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001004582.1 Gene:ctrl / 447843 ZFINID:ZDB-GENE-040912-147 Length:261 Species:Danio rerio


Alignment Length:281 Identity:88/281 - (31%)
Similarity:138/281 - (49%) Gaps:43/281 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLATILGAQAVDWNSVKNLNIETPMPKVHGETLPSGRITGGQIAEPNQFPYQVGLLLYITGGAAW 74
            |:|:.||.           .:....|.:.|    ..||..|:.|....:|:||.  |..:.|..:
Zfish    10 LVASTLGC-----------GVPAIKPVISG----YNRIVNGENAVSGSWPWQVS--LQQSNGFHF 57

  Fly    75 CGGTIISDRWIITAAHCTDSLTTGVD-VYLGAHDRTNAKEEGQQIIFVETKNV---IVHEDWIAE 135
            |||::|:..|::|||||  .:..|.. |.||.|||.::.|.      |:.|::   |.|..:.::
Zfish    58 CGGSLINQYWVVTAAHC--RVQAGYHYVILGEHDRGSSAES------VQVKSIAKAITHPYYNSQ 114

  Fly   136 TITNDISLIKLPVPIEFNKYIQPAKLPVKSDSYSTYGGENAIASGWGKISDSATGATD---ILQY 197
            ...|||:|:||..|.:....|.|..|...|.|..:  |...:.:||||     ||:|.   |||.
Zfish   115 NFNNDITLLKLSSPAQLTSRISPVCLAASSTSIPS--GTRCVTTGWGK-----TGSTSSPRILQQ 172

  Fly   198 ATVPIMNNSGCSP-WYFGLVAASNICIKTTGGISTCNGDSGGPLVLD-DGSNTLIGATSFGIALG 260
            ..:|:::.:.|.. |....:..:.||...: |:|:|.||||||||.: .|:...:|..|:|.: .
Zfish   173 TALPLLSPAQCKQYWGQNRITDAMICAGAS-GVSSCQGDSGGPLVCESSGAWYQVGIVSWGTS-D 235

  Fly   261 CEVGWPGVFTRITYYLDWIEE 281
            |.|..|.|:.|::|...||::
Zfish   236 CNVRTPAVYARVSYLRQWIDQ 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 80/241 (33%)
Tryp_SPc 47..282 CDD:238113 81/244 (33%)
ctrlNP_001004582.1 Tryp_SPc 31..254 CDD:214473 80/241 (33%)
Tryp_SPc 32..257 CDD:238113 81/244 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.