DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and Jon99Ci

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster


Alignment Length:266 Identity:100/266 - (37%)
Similarity:145/266 - (54%) Gaps:23/266 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 IETPMPKVHGETLP------SGRITGGQIAEPNQFPYQVGLLLYITGGAAWCGGTIISDRWIITA 88
            :..|...||...|.      .||||.|.:|...|.||.||:.|...|...||||:||...|::||
  Fly    18 LTVPHSLVHPRDLEIRHGGIEGRITNGNLASEGQVPYIVGVSLNSNGNWWWCGGSIIGHTWVLTA 82

  Fly    89 AHCTDSLTTGVD---VYLGAHDRTNAKEEGQQIIFVETKNVIVHEDWIAETITNDISLIKLPVPI 150
            |||    |.|.|   :|.||   .|..|...:.. |.::|.|.:..::.  :.:|::|||.| .:
  Fly    83 AHC----TAGADEASLYYGA---VNYNEPAFRHT-VSSENFIRYPHYVG--LDHDLALIKTP-HV 136

  Fly   151 EFNKYIQPAKLPVKSDSYSTYGGENAIASGWGKISDSATGATDILQYATVPIMNNSGCSPWYFGL 215
            :|...:...:||...|.|::|......|:|||.|.|.:....| |:...:.:::.:.|..:|...
  Fly   137 DFYSLVNKIELPSLDDRYNSYENNWVQAAGWGAIYDGSNVVED-LRVVDLKVISVAECQAYYGTD 200

  Fly   216 VAASN-ICIKTTGGISTCNGDSGGPLVLDDGSNTLIGATSFGIALGCEVGWPGVFTRITYYLDWI 279
            .|:.| ||::|..|.:||.||||||||..:| :.|||.|||..|.||:||.|..|||:|.||:||
  Fly   201 TASENTICVETPDGKATCQGDSGGPLVTKEG-DKLIGITSFVSAYGCQVGGPAGFTRVTKYLEWI 264

  Fly   280 EEKSGV 285
            :|::|:
  Fly   265 KEETGI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 91/236 (39%)
Tryp_SPc 47..282 CDD:238113 92/238 (39%)
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 91/236 (39%)
Tryp_SPc 41..266 CDD:238113 92/237 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470909
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.950

Return to query results.
Submit another query.