DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and CG11843

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:282 Identity:80/282 - (28%)
Similarity:131/282 - (46%) Gaps:35/282 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ILGAQAVDWNSVKNLNIETPMPKVHGETLPSGRITGGQIAEPNQFPY--QVGLLLYITGGAAW-C 75
            :|...:::...:.|....||:            |.||..|:|.:||:  ::|.....:..|.| |
  Fly    47 LLPGASIESRIIDNCRSYTPL------------IVGGHPAQPREFPHMARLGRRPDPSSRADWFC 99

  Fly    76 GGTIISDRWIITAAHCTDSLTTGVDVY-LGAHDRTNAKEEGQQIIFVETKNVIVHEDWIAETITN 139
            ||.:||:|:::|||||.:|....|:|. ||..|..:..|:.....:: ....|.|..:......:
  Fly   100 GGVLISERFVLTAAHCLESERGEVNVVRLGELDFDSLDEDAAPRDYM-VAGYIAHPGYEDPQFYH 163

  Fly   140 DISLIKLPVPIEFNKYIQPAKLPVKSDSYSTYGGENAIASGWGKISDSATGATDILQYATVPIMN 204
            ||.|:||...:.|:.|..||.||.:.:..|    ::.||.|||....:...:..:|: ..:....
  Fly   164 DIGLVKLTEAVVFDLYKHPACLPFQDERSS----DSFIAVGWGSTGLALKPSAQLLK-VKLQRYG 223

  Fly   205 NSGC--------SPWYFGLVAASNICIKTTGGISTCNGDSGGPLVLDDGS----NTLIGATSFGI 257
            |..|        ..:..|....:.:|:.:.....||||||||||::....    ..::|.||.|:
  Fly   224 NWVCKKLLTRQVEEFPRGFDGNNQLCVGSEMAQDTCNGDSGGPLLMYHREYPCMYVVVGITSAGL 288

  Fly   258 ALGCEVGWPGVFTRITYYLDWI 279
            :.| ..|.||::||:..||.||
  Fly   289 SCG-SPGIPGIYTRVYPYLGWI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 74/248 (30%)
Tryp_SPc 47..282 CDD:238113 76/249 (31%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 76/249 (31%)
Tryp_SPc 68..309 CDD:214473 74/247 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437160
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.