DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and CG11842

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster


Alignment Length:313 Identity:90/313 - (28%)
Similarity:137/313 - (43%) Gaps:50/313 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLLLATILGAQAVD--------------WNSVKNLNIETPMPKVHGETLP-----SGRITGGQIA 53
            |||::.:..|.|.|              |......:.......:..:||.     :..|.||..|
  Fly    15 VLLVSFVAWASAQDSDIARTCTAYKRSVWEETSEFSFLIENAPIIYKTLDKCTSYAPLIIGGGPA 79

  Fly    54 EPNQFPYQVGL-LLYITGGAAW-CGGTIISDRWIITAAHCTDSLTTGVDV-YLG--AHDRTNAKE 113
            .|.:||:...| .....|...| ||||:||||.::|||||..|....|:: .||  ..|..|...
  Fly    80 VPKEFPHAARLGHKDENGEVEWFCGGTLISDRHVLTAAHCHYSPQGSVNIARLGDLEFDTNNDDA 144

  Fly   114 EGQQIIFVETKNVIVHEDWIAETITNDISLIKLPVPIEFNKYIQPAKLPVKSDSYSTYGGENAIA 178
            :.:..   :.|:...|.::....|.||||:::|..|:.||.|..||.||......    |.:.||
  Fly   145 DPEDF---DVKDFTAHPEFSYPAIYNDISVVRLSRPVTFNDYKHPACLPFDDGRL----GTSFIA 202

  Fly   179 SGWGKI------SDSATGATDILQYAT---VPIMNNSGCSPWYFGLVAASNICIKTTGGISTCNG 234
            .|||::      .:.......:..|.|   :....|.....   |..|.:.:||.:.....||||
  Fly   203 IGWGQLEIVPRTENKKLQKVKLYNYGTRCRITADRNDELPE---GYNATTQLCIGSNEHKDTCNG 264

  Fly   235 DSGGPLVLDDGSNT----LIGATSFGIALGCEV-GWPGVFTRITYYLDWIEEK 282
            |||||:::......    ::|.||.|:|  |:. ..|.::||:.:|||||:::
  Fly   265 DSGGPVLIYHMDYPCMYHVMGITSIGVA--CDTPDLPAMYTRVHFYLDWIKQQ 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 79/251 (31%)
Tryp_SPc 47..282 CDD:238113 81/253 (32%)
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 81/253 (32%)
Tryp_SPc 73..312 CDD:214473 79/250 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437158
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.