DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and CG11841

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:269 Identity:74/269 - (27%)
Similarity:108/269 - (40%) Gaps:64/269 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 ITGGQIAEPNQFPYQVGLLLYITGG-AAW-CGGTIISDRWIITAAHCTDSLTTGVDVYLGAHDRT 109
            |..|..|||.:||:...|....|.. ..| ||||:||:|.::|||||          :...|...
  Fly    72 IVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHC----------FFSEHGEV 126

  Fly   110 NAKEEGQQIIFVETKN----------VIVHEDWIAETITNDISLIKLPVPIEFNKYIQPAKLPVK 164
            |....|:.....:|.:          :..|..:....:.|||.:::|...::||:|..||.||..
  Fly   127 NVVRLGELEFDTDTDDAEPEDFGVLALKAHPGFENPQLYNDIGIVQLDREVKFNRYKHPACLPFD 191

  Fly   165 SDSYSTYGGENAIASGWGK------------------ISDSATGATDILQYATVPIMNNSGCSPW 211
            .....    |:.||.|||:                  ..|....:.|    |...:.|       
  Fly   192 DGEQH----ESFIAIGWGQKKFAQKESKKLLKVQLQGYKDRCVSSVD----ANDELPN------- 241

  Fly   212 YFGLVAASNICIKTTGGISTCNGDSGGPLVLDDGSNT----LIGATSFGIALGCEV-GWPGVFTR 271
              |....|.:||.:.....|||||||||::.......    ::|.||.||.  |.. ..|..:||
  Fly   242 --GYEPKSQLCIGSRDNKDTCNGDSGGPVLAYHKDLACMYHVMGITSAGIT--CSTPDIPSAYTR 302

  Fly   272 ITYYLDWIE 280
            :.|:|:||:
  Fly   303 VHYFLNWIK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 72/266 (27%)
Tryp_SPc 47..282 CDD:238113 74/269 (28%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 73/267 (27%)
Tryp_SPc 72..310 CDD:214473 72/266 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437159
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.