DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and CG4815

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:241 Identity:59/241 - (24%)
Similarity:96/241 - (39%) Gaps:54/241 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 VGLLLYITGGAAWCGGTIISDRWIITAAHCTDSLTTGVDVYLGA-------HDRTNAKEEGQQII 119
            ||:.|: .|....|..|:::.|.|:|||||.::|.......:|.       |.....|   .::|
  Fly    49 VGIQLF-NGRKLVCSATLLTPRHILTAAHCFENLNRSKFHVIGGKSAEFTWHGNNFNK---NKLI 109

  Fly   120 FVETKNVIVHEDWIAETITNDISLIKLPVPIEFNKYIQPAKLPVKSDSYSTYGGENAIASGW--- 181
            .|:     :|..:.......|:::.|...|:. :|||..|:| .:|   ..:..:..||:||   
  Fly   110 RVQ-----IHPKYAKMKFIADVAVAKTKYPLR-SKYIGYAQL-CRS---VLHPRDKLIAAGWGFE 164

  Fly   182 GKISDSATGATDILQYATVPIMNNSGCSPWYFGLVAASNICIKTTGGISTCNGDSGGPLVLDD-- 244
            |.:.|.:...|  .:...|.|::...|.......:..:.||.......:.|.|||||||:|..  
  Fly   165 GGVWDESRKKT--FRSMKVGIVSKRDCEKQLDRKMPPNIICAGAYNNKTLCFGDSGGPLLLGRQV 227

  Fly   245 -GSNTLIGATSFGIALGCEVGW---------PGVFTRITYYLDWIE 280
             |.||                |         |.|:..:.||..:|:
  Fly   228 CGINT----------------WTFKCGNNEKPDVYMGVRYYAKFIK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 58/238 (24%)
Tryp_SPc 47..282 CDD:238113 59/241 (24%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 59/241 (24%)
Trypsin 49..256 CDD:278516 58/238 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471118
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.