DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and CG10232

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster


Alignment Length:274 Identity:79/274 - (28%)
Similarity:121/274 - (44%) Gaps:40/274 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 MPKVHGETLPSGRITGGQIAEPNQFPYQVGLLLY-------ITGGAAWCGGTIISDRWIITAAHC 91
            :|...|:..|..|:..|..|.||::|: :.:|:|       :|..   |.|::|:.|:::|||||
  Fly   244 LPTSCGQAPPLYRMAYGTAARPNEYPW-MAMLIYENRRLSTMTNN---CSGSLINKRYVLTAAHC 304

  Fly    92 --------TDSLTTGVDVYLGAHDRTNAKE---EGQ-QIIFVE--TKNVIVHEDWI-AETITNDI 141
                    ||.:..  .|.||.||.|...:   .|. ...|||  .:...|||.:. .....:||
  Fly   305 VVKDKMVNTDLVLR--RVRLGEHDITTNPDCDFTGNCAAPFVEIGIEYFNVHEQYFNTSRFESDI 367

  Fly   142 SLIKLPVPIEFNKYIQPAKLPVKSDSYSTYGGENAIASGWGKISDSATGATDILQYATVPIMNNS 206
            :|::|..|:.:...|.|..:|  .|....:.....|| |||...:..  .:.:|.:.|| ..|..
  Fly   368 ALVRLQTPVRYTHEILPICVP--KDPIPLHNHPLQIA-GWGYTKNRE--YSQVLLHNTV-YENRY 426

  Fly   207 GCSPWYFGLVAASNICIKTTGGISTCNGDSGGPLVLDDGSN-----TLIGATSFGIALGCEVGWP 266
            .|..........|.||.....|..:|.|||||||:|...::     .|.|..|:| :..|....|
  Fly   427 YCQDKISFFRNESQICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGIVSYG-SENCGDRKP 490

  Fly   267 GVFTRITYYLDWIE 280
            ||:|:...:..||:
  Fly   491 GVYTKTGAFFSWIK 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 74/259 (29%)
Tryp_SPc 47..282 CDD:238113 75/261 (29%)
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 75/258 (29%)
Tryp_SPc 260..503 CDD:214473 73/255 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436286
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.