DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and SPE

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster


Alignment Length:302 Identity:88/302 - (29%)
Similarity:138/302 - (45%) Gaps:51/302 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NLNIETPMPKV-----HGETLP---------SGRITGGQIAEPNQFPYQVGL---LLYITGGAAW 74
            |:....|.|..     .|:.||         :.||.||......:||:.|.|   .|:.......
  Fly   101 NIMDSEPTPSTRDALQQGDVLPGNDVCGFLFADRIFGGTNTTLWEFPWMVLLQYKKLFSETYTFN 165

  Fly    75 CGGTIISDRWIITAAHCTDSL---TTGV---DVYLGAHD-RTN----AKEEGQQI-----IFVET 123
            |||.:::.|:::||.||..|.   .:|.   .|.||..| ||:    .:..||:|     |.:|.
  Fly   166 CGGALLNSRYVLTAGHCLASRELDKSGAVLHSVRLGEWDTRTDPDCTTQMNGQRICAPKHIDIEV 230

  Fly   124 KNVIVHEDWIAETI--TNDISLIKLPVPIEFNKYIQPAKLP---VKSDSYSTYGGENAIASGWGK 183
            :..|:||.:...::  .|||:|::|...:.:..|::|..||   :..:::..||.:   .:|||.
  Fly   231 EKGIIHEMYAPNSVDQRNDIALVRLKRIVSYTDYVRPICLPTDGLVQNNFVDYGMD---VAGWGL 292

  Fly   184 ISDSATGATDILQYATVPIMNNSGCSPWYFGL---VAASNICIKTTGGISTCNGDSGGPLV--LD 243
            ..:....|  |....||.:.|.:.|...|...   :..|.:|.....|:.||.|||||||:  :.
  Fly   293 TENMQPSA--IKLKITVNVWNLTSCQEKYSSFKVKLDDSQMCAGGQLGVDTCGGDSGGPLMVPIS 355

  Fly   244 DGSNT---LIGATSFGIALGCEVGWPGVFTRITYYLDWIEEK 282
            .|...   :.|.||:|.......|||||:||...::|||::|
  Fly   356 TGGRDVFYIAGVTSYGTKPCGLKGWPGVYTRTGAFIDWIKQK 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 79/264 (30%)
Tryp_SPc 47..282 CDD:238113 80/266 (30%)
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 80/266 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436293
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.