DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and CG16710

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:287 Identity:85/287 - (29%)
Similarity:140/287 - (48%) Gaps:44/287 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NLNIETPMPKVHGETLPSGRITGGQIAEPNQFPYQVGLLLYI-TGGAAW-------CGGTIISDR 83
            |:....|..::.|..:|:.||.||:..:||:.|: :.|:||. ...:.|       |.|::|::|
  Fly    86 NMGHILPNTQICGPIMPAYRIFGGEETQPNELPW-MALILYAHRSRSVWNERLVSRCAGSLITNR 149

  Fly    84 WIITAAHCTDSLTTGVD---VYLGAHD---------RTNAKEE-GQQIIFVETKNVIVHEDWIA- 134
            :::|||||.  ..||:|   |.||.|:         ..|.:|. ..:.:.::....|.|..::. 
  Fly   150 YVLTAAHCL--RITGLDLRRVRLGEHNILSNPDCVTHINGREHCAPEHLEIDVDLSIKHRHYMVF 212

  Fly   135 -ETITNDISLIKLPVPIEFNKYIQPAKLPVKSD---SYSTYGGENAIASGWGKISDSATGATDIL 195
             |...|||:|::|..|:.:...|:|  :.|:.|   |..::.......:|||  .....|.:::|
  Fly   213 EERPYNDIALLRLKFPVRYTAQIKP--ICVQLDYIFSNPSFSNHKLQIAGWG--LSHKQGYSNVL 273

  Fly   196 QYATVPIMNNSGCS---PWYFGLVAASNICIKTTGGISTCNGDSGGPL--VLDDGSNT---LIGA 252
            ..|.|...|...||   | ..||...::||....||..||.|||||||  :::.|...   |.|.
  Fly   274 LQAYVNGRNADECSLSEP-SLGLDKETHICAGNLGGNDTCKGDSGGPLMAIMERGDEEFVYLAGI 337

  Fly   253 TSFGIALGCEVGWPGVFTRITYYLDWI 279
            ||:|.: .|..| |..:|:.:.:::||
  Fly   338 TSYGYS-QCGYG-PAAYTKTSKFVEWI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 79/266 (30%)
Tryp_SPc 47..282 CDD:238113 80/267 (30%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855
Tryp_SPc 105..362 CDD:214473 79/266 (30%)
Tryp_SPc 106..362 CDD:238113 78/265 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436287
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.