DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and CG31199

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:322 Identity:61/322 - (18%)
Similarity:110/322 - (34%) Gaps:85/322 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ATVLLLATILGAQ------------AVDWNSVKNLNIETPMPKVHG--ETLPSGRITGGQIAEPN 56
            |.:|||..:.|.:            |.|.:.:.|:.....:|..|.  ..:..|:...|:|.:..
  Fly     6 AVLLLLVGLFGPEVRSAKVNDDQCGAFDEDQMLNMQSTFAIPTEHQWVARIVYGKGFEGKIRDNG 70

  Fly    57 QFPYQVGLLLYITGGAAWCGGTIISDRWIITAAHC---TDSLTTGVDVYLGAHDRTN------AK 112
                              |.|.::|.|.::..|||   .:.:.....|:||.|:::.      .:
  Fly    71 ------------------CLGVLVSKRTVLAPAHCFVQYNGVAEAFSVHLGVHNKSAPVGVRVCE 117

  Fly   113 EEG------QQIIFVETKNVIVHEDWIAETITNDISLIKLPVPIEFNKYIQPAKLPVKSDSYSTY 171
            .:|      |:|...|   :.:|.|:.:.|:.|.::::.|....:....:.|..:|..|....|.
  Fly   118 TDGYCVRPSQEIKLAE---IAIHPDYDSRTLKNSLAVLTLQRDAKIYPNVMPICMPPPSLLNETL 179

  Fly   172 GGENAIASGWGKISDSATGATDILQYAT-VPIMNNSGCSPWYFGLVAASNICIKTTGGISTCNGD 235
            ..:..:.:|.....|        .:..| |..::...|......||.:||         :.|...
  Fly   180 VAQTFVVAGLRVFED--------FRLKTWVNTLSRGFCQSKVKTLVTSSN---------TVCGYH 227

  Fly   236 S-------GGPLVLDDGSNTLIGATSFGIALGCEVGW-------PGVFTRITYYLDWIEEKS 283
            .       |.|||   |.......|.....:|..:.|       ...|..|..|:|:|.:.|
  Fly   228 KQPVAYYLGAPLV---GLQKKGHVTQNYYLVGIMIDWRWENNRIMSSFLAIRNYMDFIRQNS 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 48/262 (18%)
Tryp_SPc 47..282 CDD:238113 49/264 (19%)
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:304450 45/252 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.