DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and CG9649

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:305 Identity:68/305 - (22%)
Similarity:121/305 - (39%) Gaps:66/305 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KFACATVLLLATILGAQAVDWNSVKNLNIETPMPKVHGETLPSGRITGGQIAEPNQFPYQVGLLL 66
            ||...|:..|:.|.|.:.|         |:||.            |..|...|..|.|:...|..
  Fly   233 KFYPQTIGQLSGICGREKV---------IQTPF------------IHNGIEVERGQLPWMAALFE 276

  Fly    67 YITGGAAW---CGGTIISDRWIITAAHCTDSLTTGVDVYLGAHDRTNAKE-EGQQIIFVETKN-- 125
            ::  |..:   ||||:||.|.:|:||||.               |..::. .|::.|....:|  
  Fly   277 HV--GRDYNFLCGGTLISARTVISAAHCF---------------RFGSRNLPGERTIVSLGRNSL 324

  Fly   126 -------------VIVHEDWIAETITN-DISLIKLPVPIEFNKYIQPAKLPVKSDSYSTYGGENA 176
                         :::||.:.....|: |::|::|...::...||:|..|..::.......|..:
  Fly   325 DLFSSGATLGVARLLIHEQYNPNVYTDADLALLQLSNHVDIGDYIKPICLWNENFLLELPSGHKS 389

  Fly   177 IASGWGKISDSATGATDILQYATVPIMNNSGC----SPWYFGLVAASNICIKTTGGISTCNGDSG 237
            ..:|||: .:.....|.:.:.....|:....|    |......:.:..||.........|:||||
  Fly   390 YVAGWGE-DEKGNRNTRLAKMTDTDIITQWECRGNLSEENAKFITSHTICASNAQASGPCSGDSG 453

  Fly   238 GPLVLDDGSNTLI-GATSFG--IALGCEVGWPGVFTRITYYLDWI 279
            |.|:|.:....:: |..|.|  :...|.:..|.::|.:..:::|:
  Fly   454 GGLMLQEQDIWMLRGVVSAGQRMTNRCNLTLPVIYTDVAKHIEWL 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 57/259 (22%)
Tryp_SPc 47..282 CDD:238113 58/260 (22%)
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 57/258 (22%)
Tryp_SPc 259..497 CDD:214473 56/255 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471089
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.