DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and snk

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster


Alignment Length:263 Identity:71/263 - (26%)
Similarity:124/263 - (47%) Gaps:47/263 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 ITGGQIAEPNQFPYQVGLLLYITGGA-----AW-CGGTIISDRWIITAAHCTDSLTTGVD-VYLG 104
            |.||.......||:...|......|:     .| |||.::|:.:::|||||..|.:...| |.||
  Fly   186 IVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTAAHCATSGSKPPDMVRLG 250

  Fly   105 AH--DRTNAKEEGQQIIFVETKNVIVHEDWIAETITNDISLIKLPVPIEFNKYIQPA-------- 159
            |.  :.|:|.::..:|:.     :::|..:.:....:||:|:||...::|::.::||        
  Fly   251 ARQLNETSATQQDIKILI-----IVLHPKYRSSAYYHDIALLKLTRRVKFSEQVRPACLWQLPEL 310

  Fly   160 KLPVKSDSYSTYGGENAIASGWGKISDSATGATDILQYATVPIMNNSGCSPWY-------FGLVA 217
            ::|            ..:|:|||: ::.....::.|:...:.::....|...|       .|::.
  Fly   311 QIP------------TVVAAGWGR-TEFLGAKSNALRQVDLDVVPQMTCKQIYRKERRLPRGIIE 362

  Fly   218 ASNICIKTTGGISTCNGDSGGPL--VLDDGSNT--LIGATSFGIALGCEVGWPGVFTRITYYLDW 278
            .........||..||.||||||:  :|.:.:..  ::|.|||| ........|||:||:..||||
  Fly   363 GQFCAGYLPGGRDTCQGDSGGPIHALLPEYNCVAFVVGITSFG-KFCAAPNAPGVYTRLYSYLDW 426

  Fly   279 IEE 281
            ||:
  Fly   427 IEK 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 68/259 (26%)
Tryp_SPc 47..282 CDD:238113 71/263 (27%)
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 71/263 (27%)
Tryp_SPc 186..427 CDD:214473 68/259 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437040
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.