DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and CG13318

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:318 Identity:88/318 - (27%)
Similarity:132/318 - (41%) Gaps:56/318 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ACATVLLLATILGAQAVDWNSVKNLNIETPMPKVHGETLPSGRIT-----------------GGQ 51
            :||..|..|...|:..:|...|.|....|........|...|.:.                 |..
  Fly    98 SCANPLPTAPSDGSGQIDIRIVNNGGYPTVPTTSSTLTCSYGLVACCQAGSYQCGRRFPPPPGST 162

  Fly    52 IAEPNQ-----FPYQVGLL----LYITGGAAWCGGTIISDRWIITAAHCTDSL-TTGVDVYLGAH 106
            .|.|.|     :|:|..||    :|:.|||      :|:.:.::||||...:| .|...|.||..
  Fly   163 TAAPGQASFGAYPWQAALLTTADVYLGGGA------LITAQHVLTAAHKVYNLGLTYFKVRLGEW 221

  Fly   107 DRTNAKEE-GQQIIFVETKNVIVHEDWIAETITNDISLIKL--PVPIEFNKYIQPAKLPVKSDSY 168
            |..:..|. ..|.:::  .||.|:..:....:.||::::||  ||.:.....:....||..|   
  Fly   222 DAASTSEPIPAQDVYI--SNVYVNPSFNPNNLQNDVAILKLSTPVSLTSKSTVGTVCLPTTS--- 281

  Fly   169 STYGGENAIASGWGKISDSATGATDILQ-YATVPIMNNSGCSPWY--------FGLVAASNICIK 224
              :.|:....:||||....||||...:: ...||::.|:.|....        |.|...|.||..
  Fly   282 --FVGQRCWVAGWGKNDFGATGAYQAIERQVDVPLIPNANCQAALQATRLGSSFVLSPTSFICAG 344

  Fly   225 TTGGISTCNGDSGGPLV-LDDGSNTLIGATSFGIALGC-EVGWPGVFTRITYYLDWIE 280
            ...|...|.||.|.||| ..:|...::|..::||  || :.|.|||:..:..||.||:
  Fly   345 GEAGKDACTGDGGSPLVCTSNGVWYVVGLVAWGI--GCAQAGVPGVYVNVGTYLPWIQ 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 75/273 (27%)
Tryp_SPc 47..282 CDD:238113 77/275 (28%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 73/247 (30%)
Tryp_SPc 169..399 CDD:214473 71/244 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435438
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.