DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and ela2

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001132936.1 Gene:ela2 / 403061 ZFINID:ZDB-GENE-041117-1 Length:266 Species:Danio rerio


Alignment Length:284 Identity:106/284 - (37%)
Similarity:146/284 - (51%) Gaps:36/284 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLLLATILGAQAVDWNSVKNLNIETPMPKVHGETLPSGRITGGQIAEPNQFPYQVGLLLYITGGA 72
            |:|...|.||......:.|.::               .|:.||....||.:|:|.. |.|.:|.:
Zfish     4 VILALFIAGAYGCGQPTYKPID---------------SRVVGGSDVRPNSWPWQAS-LQYQSGSS 52

  Fly    73 AW--CGGTIISDRWIITAAHCTDSLTTGVDVYLGAHDRTNAKEEGQQIIFVETKNVIVHEDWIAE 135
            .:  ||||:|..:|::|||||..|.|  ..|.||.|:...:.|.|.|.|  ....:||||:|.:.
Zfish    53 FYHTCGGTLIDKQWVLTAAHCISSRT--YRVLLGKHNLPLSSESGSQAI--SPARIIVHENWDSY 113

  Fly   136 TITNDISLIKLPVPIEFNKYIQPAKLPVKSDSYSTYGGEN-AIASGWGKISDSATGA--TDILQY 197
            .|.|||:||||..|:.|...|.||.||   ||.|.....: ...:|||::   .||.  .||||.
Zfish   114 NIRNDIALIKLSTPVTFTDKISPACLP---DSGSILPHNSPCYVTGWGRL---WTGGPIADILQQ 172

  Fly   198 ATVPIMNNSGC--SPWYFGLVAASNICIKTTGGISTCNGDSGGPLVLD--DGSNTLIGATSFGIA 258
            |.:||::.:.|  |.|:..||....:|....|.:|:|||||||||...  ||:..:.|..|||.:
Zfish   173 ALLPIVDQATCTKSDWWGNLVTDLMVCAGGDGVVSSCNGDSGGPLNCQRRDGTWDVHGIVSFGSS 237

  Fly   259 LGCEV-GWPGVFTRITYYLDWIEE 281
            |||.. ..|.||||::.|:.||.:
Zfish   238 LGCNYPKKPSVFTRVSGYIPWINK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 98/242 (40%)
Tryp_SPc 47..282 CDD:238113 99/245 (40%)
ela2NP_001132936.1 Tryp_SPc 27..259 CDD:214473 98/242 (40%)
Tryp_SPc 28..262 CDD:238113 99/245 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 1 0.900 - - E33208_3BBU3
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.