DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and CG14088

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster


Alignment Length:260 Identity:58/260 - (22%)
Similarity:99/260 - (38%) Gaps:69/260 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 LLLYITG-GAAW-----CG---------------------------GTIISDRWIITAAHCTDSL 95
            ||::::| |:|.     ||                           ||:|.:|:|:|..||.||:
  Fly    14 LLIFLSGTGSAQFLGNICGERRDGLSPDIVGPWTAILHHFGRIVGVGTLIHERFILTDVHCGDSI 78

  Fly    96 TTGVDVYLGAHDRTNAKEEGQQIIFVETKNVIVHEDWIAETITNDISLIKLPVPIEFNKYIQP-- 158
            .. :...||.:.|..::.....|:.....|.    ::..||..|::.|:||...:.:.::|.|  
  Fly    79 GV-IRARLGEYGRIGSELAEDHIVAAFFSNA----NFNPETQANNMGLMKLLRTVVYKEHIIPVC 138

  Fly   159 ----AKLPVKSDSYSTYGGENAIASGWGKISDSATGATDILQYATVPIMNNSGCSPWYFGLVAAS 219
                :::...:|....:.|     :.| |.||.    :.:|:..|| |.....|.....|...|.
  Fly   139 ILMDSRMQTFADELDYFNG-----TTW-KNSDK----SPMLRSKTV-IRMPQACGKLDHGQFCAG 192

  Fly   220 NICIKTTGGISTCNGDSGGPLVLD---DGSNTLIGATSFGIALGCEVGWPG--VFTRITYYLDWI 279
            :      ..:.:|:..||..|..:   .|.|..:   .||||...||....  .:|.:.....||
  Fly   193 H------KDLDSCDEPSGAALTREIDYIGPNRTV---LFGIANSVEVKCSNSRTYTDVVQLHQWI 248

  Fly   280  279
              Fly   249  248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 56/258 (22%)
Tryp_SPc 47..282 CDD:238113 58/260 (22%)
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 51/232 (22%)
Tryp_SPc 42..248 CDD:214473 49/230 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.