Sequence 1: | NP_648017.1 | Gene: | CG10472 / 38688 | FlyBaseID: | FBgn0035670 | Length: | 290 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_649100.2 | Gene: | CG14088 / 40098 | FlyBaseID: | FBgn0036858 | Length: | 289 | Species: | Drosophila melanogaster |
Alignment Length: | 260 | Identity: | 58/260 - (22%) |
---|---|---|---|
Similarity: | 99/260 - (38%) | Gaps: | 69/260 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 64 LLLYITG-GAAW-----CG---------------------------GTIISDRWIITAAHCTDSL 95
Fly 96 TTGVDVYLGAHDRTNAKEEGQQIIFVETKNVIVHEDWIAETITNDISLIKLPVPIEFNKYIQP-- 158
Fly 159 ----AKLPVKSDSYSTYGGENAIASGWGKISDSATGATDILQYATVPIMNNSGCSPWYFGLVAAS 219
Fly 220 NICIKTTGGISTCNGDSGGPLVLD---DGSNTLIGATSFGIALGCEVGWPG--VFTRITYYLDWI 279
Fly 280 279 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10472 | NP_648017.1 | Tryp_SPc | 46..279 | CDD:214473 | 56/258 (22%) |
Tryp_SPc | 47..282 | CDD:238113 | 58/260 (22%) | ||
CG14088 | NP_649100.2 | Tryp_SPc | 42..251 | CDD:304450 | 51/232 (22%) |
Tryp_SPc | 42..248 | CDD:214473 | 49/230 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24260 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |