DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and CG18223

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster


Alignment Length:246 Identity:61/246 - (24%)
Similarity:107/246 - (43%) Gaps:56/246 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 GGAAWCGGTIISDRWIITAAHCTDSLTTGVDVYLGAHDRTNAKEEGQQIIFV------------- 121
            |...:|||.|||..:|:|:|||             |.|:.......:.::.|             
  Fly    74 GDNHFCGGVIISRTYILTSAHC-------------AMDKRKIVHRSRVLVVVAGTTNRLKSRKGL 125

  Fly   122 ----ETKNVIVHEDWIAETI--TNDISLIKL--PVPIEFNKYIQPAKLPVKSDSYSTYGGENAIA 178
                |.|.:.|.:.:   |:  ||:|:|:.|  .:|:: |..:....||.....    .|.|...
  Fly   126 SLNMEVKKIFVPDKF---TVFNTNNIALMMLAKKLPLD-NPLVGVINLPTADPE----PGLNYTV 182

  Fly   179 SGWGKISDSATGATDILQYATVPIMNNSGCSP----WYFGLVAASNICIKTTGGISTCNGDSGGP 239
            .|||:|......|:||| :..|.::....|..    :...::.|.|  :..|...:.|.||:|.|
  Fly   183 LGWGRIFKGGPLASDIL-HIDVELLPRDICEKKVHIFKEEMMCAGN--LNNTMDENPCAGDTGSP 244

  Fly   240 LVLDDGSNTLIGATSFGIALGCEVGWPGVFTRITYYLDWIEEKSGVVNNGD 290
            |:.::   |:.|..|:.:..|.:. .|.::|.:..::|||   :|::||.:
  Fly   245 LIFNE---TVFGVVSYRVGCGSKT-LPSIYTNVYMHMDWI---NGIMNNNE 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 56/233 (24%)
Tryp_SPc 47..282 CDD:238113 58/236 (25%)
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 58/239 (24%)
Tryp_SPc 60..280 CDD:214473 56/233 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436873
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.