DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and Jon74E

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster


Alignment Length:289 Identity:118/289 - (40%)
Similarity:164/289 - (56%) Gaps:33/289 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ATVLLLATILGAQAVDWNSVKNLNIETPMPKVHGETLPSGRITGGQIAEPNQFPYQVGLL----- 65
            :|:|:...||    |...|:..|::.      ||   ..|||.||::|..|||||||||.     
  Fly     4 STILVFLLIL----VQGRSISCLDMG------HG---IGGRIAGGELARANQFPYQVGLSIEEPN 55

  Fly    66 -LYITGGAAWCGGTIISDRWIITAAHCTDSLTTGVDVYLGAHDRTNAKEEGQQIIFVETKNVIVH 129
             :|     .|||.::||||:::|||||.:. ...:..|||...|...:    |:|......|.:|
  Fly    56 DMY-----CWCGASLISDRYLLTAAHCVEK-AVAITYYLGGVLRLAPR----QLIRSTNPEVHLH 110

  Fly   130 EDWIAETITNDISLIKLPVPIEFNKYIQPAKLPVKSDSYSTYGGENAIASGWGKISDSATGATDI 194
            .||..:::.|||:|::||........|:|.:||..|.|.::|....|||||||:::|.:|..:|.
  Fly   111 PDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMNDESTAISDN 175

  Fly   195 LQYATVPIMNNSGCSPWYFGLVAASNICIKTTGGISTCNGDSGGPLVLDD---GSNTLIGATSFG 256
            |:|....:.:|..|. :.:..:..:|||:.||||.|||.||||||||..|   .::.|||.||:|
  Fly   176 LRYVYRFVESNEDCE-YSYANIKPTNICMDTTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYG 239

  Fly   257 IALGCEVGWPGVFTRITYYLDWIEEKSGV 285
            ...||..|:|.||||||.|||||.|.|||
  Fly   240 KKSGCTKGYPSVFTRITAYLDWIGEVSGV 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 102/241 (42%)
Tryp_SPc 47..282 CDD:238113 103/243 (42%)
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 102/241 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
99.080

Return to query results.
Submit another query.