DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and CG11529

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster


Alignment Length:279 Identity:107/279 - (38%)
Similarity:153/279 - (54%) Gaps:29/279 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LATILGAQAVDWNSVKNLNIETPMPKVHGETLPSGRITGGQIAEPNQFPYQVGLLLYITGGAAW- 74
            :|.:||.      :|..|.:..|.|.   ::...|:...|:|   .:|||||.|:    |...| 
  Fly     6 IAHLLGL------AVIMLMMWKPTPT---DSYAVGQSKYGRI---EKFPYQVMLI----GKQLWR 54

  Fly    75 ----CGGTIISDRWIITAAHCTDSLTTGVDVYLGAHDRTNAKEEGQQIIFVETKNVIVHEDWIAE 135
                ||||::..|||:||.|||..: |..|||||.....:.:..|..::  .:...||||.:..|
  Fly    55 KRILCGGTLLDKRWILTAGHCTMGV-THYDVYLGTKSVEDTEVSGGLVL--RSNKFIVHERFNPE 116

  Fly   136 TITNDISLIKLPVPIEFNKYIQPAKLPVKSDSYSTYGGENAIASGWGKISDSATGATDILQYATV 200
            |..|||:|:|||..:.|...||||.||.:. .:..:.|.:.:|||||.:.:...  :|.:||..:
  Fly   117 TAANDIALVKLPQDVAFTPRIQPASLPSRY-RHDQFAGMSVVASGWGAMVEMTN--SDSMQYTEL 178

  Fly   201 PIMNNSGCSPWYFGLVAASNICIKTTGGISTCNGDSGGPLVLDDGSNTLIGATSFGIALGCEVGW 265
            .:::|:.|:..| .:|.:..||.|.....:.|.|||||||||.| :..::|.||||.|.|||...
  Fly   179 KVISNAECAQEY-DVVTSGVICAKGLKDETVCTGDSGGPLVLKD-TQIVVGITSFGPADGCETNI 241

  Fly   266 PGVFTRITYYLDWIEEKSG 284
            ||.|||:|:||||||.|.|
  Fly   242 PGGFTRVTHYLDWIESKIG 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 94/237 (40%)
Tryp_SPc 47..282 CDD:238113 97/239 (41%)
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 96/235 (41%)
Tryp_SPc 37..255 CDD:214473 93/232 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.