DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and CG3088

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster


Alignment Length:279 Identity:88/279 - (31%)
Similarity:130/279 - (46%) Gaps:34/279 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLATILGAQAVDWNSVKNLNIETPMPKVHGETLPSGRITGGQIAEPNQFPYQVGLLLYITGGAA- 73
            ||...||...|...|.|..:.:           |...||.|..|...|.||.||:..    |.: 
  Fly     3 LLVVFLGLTLVAAGSAKKDSED-----------PDHIITNGSPAYEGQAPYVVGMAF----GQSN 52

  Fly    74 -WCGGTIISDRWIITAAHCTDSLTTGVDVYLGAHDRTNAKEEGQQIIFVETKNVIVHEDWIAETI 137
             ||.||||.|.||:|:|.|... ::||.:|.||    ....:.|..:.|.|...:        |.
  Fly    53 IWCSGTIIGDTWILTSAQCLTG-SSGVTIYFGA----TRLSQAQFTVTVGTSEYV--------TG 104

  Fly   138 TNDISLIKLPVPIEFNKYIQPAKLPVKSDSYSTYGGENAIASGWGKISDSATGATDILQYATVPI 202
            ...::|:::| .:.|:..:....||...:....|....|...||| ::..:.|.||.||...:.|
  Fly   105 NQHLALVRVP-RVGFSNRVNRVALPSLRNRSQRYENWWANVCGWG-VTTFSNGLTDALQCVDLQI 167

  Fly   203 MNNSGCSPWYFGLVAASNI-CIKTTGGISTCNGDSGGPLVLDDGSNTLIGATSFGIALGCEVGWP 266
            |:|:.|..:|.....:..| |.:|..|.|||.||:|.||:....| |::|.::|..:.||.:|.|
  Fly   168 MSNNECIAFYGSTTVSDQILCTRTPSGRSTCFGDAGSPLITKQDS-TVVGISAFVASNGCTLGLP 231

  Fly   267 GVFTRITYYLDWIEEKSGV 285
            ..|.|||..||||.:::|:
  Fly   232 AGFARITSALDWIHQRTGI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 77/235 (33%)
Tryp_SPc 47..282 CDD:238113 79/237 (33%)
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 79/236 (33%)
Tryp_SPc 29..244 CDD:214473 77/234 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470904
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.