DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and Jon66Ci

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster


Alignment Length:287 Identity:110/287 - (38%)
Similarity:151/287 - (52%) Gaps:43/287 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TVLLLATILGAQAVDWNSVKNLNIETPMPKVHGETLP-----SGRITGGQIAEPNQFPYQVGLLL 66
            |:|.||.   |.|..:.||           ||.:.|.     .||||.|..||..:.||.|||..
  Fly     6 TILALAV---ASASAYESV-----------VHPKDLSKVAKIEGRITNGYPAEEGKAPYTVGLGF 56

  Fly    67 YITGGAAWCGGTIISDRWIITAAHCT--DSLTTGVDVYLGAHDRTNAKEEGQQIIFVETKNVIVH 129
               .|..||||:|||:.|::||.||.  |::|    ||.||..||||    |...:|.:.|.|.|
  Fly    57 ---SGGWWCGGSIISNEWVLTAEHCIGGDAVT----VYFGATWRTNA----QFTHWVGSGNFITH 110

  Fly   130 EDWIAETITNDISLIKLPVPIEFNKYIQPAKLPVKSDSYSTYGGENAIASGWGKISDSATGATDI 194
            .       :.||:||::| .::|...:...:||..:|.|:.|....|:|.|||...|.:. ..|.
  Fly   111 G-------SADIALIRIP-HVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSP-LPDY 166

  Fly   195 LQYATVPIMNNSGCSPWY-FGLVAASNICIKTTGGISTCNGDSGGPLVLDDGSNTLIGATSFGIA 258
            ||...:.|::||.|:.:| .|.|..:.||::...|..||.||||||||..|||. |:|.|::...
  Fly   167 LQCVDLQIIHNSECASYYGTGTVGDNIICVRVVDGKGTCGGDSGGPLVTHDGSK-LVGVTNWVSG 230

  Fly   259 LGCEVGWPGVFTRITYYLDWIEEKSGV 285
            .||:.|.|..|.|:||:||||.:.:|:
  Fly   231 AGCQAGHPAGFQRVTYHLDWIRDHTGI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 95/235 (40%)
Tryp_SPc 47..282 CDD:238113 96/237 (41%)
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 95/235 (40%)
Tryp_SPc 37..254 CDD:238113 96/237 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470912
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.