DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and CG33460

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster


Alignment Length:230 Identity:58/230 - (25%)
Similarity:98/230 - (42%) Gaps:32/230 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 TGGAAWCGGTIISDRWIITAAHCTDSLTTGVDVYLGAHDR-TNAKEEGQQIIFVETKNVIVHEDW 132
            |.|:.:|.||:|:|.:|:|||.|.  ....|.|.||...| .|...|...:.:     .:::..:
  Fly    51 TDGSIFCAGTLITDVFILTAASCI--RPNAVKVRLGEFGRYPNELPEDHLVHY-----FLMYRLF 108

  Fly   133 IAETITNDISLIKLPVPIEFNKYIQPA--KLPVKSDSYSTYGGENAIASGWGKISDSATGATDIL 195
            ..|::.|:|.|:||...::...||.|.  .|..::...||.   ..|.:.|  :.||....|..|
  Fly   109 NNESLANNIGLLKLTKRVQITDYIMPVCIVLNPQNQQLSTM---RFIGNAW--MEDSNVSLTKEL 168

  Fly   196 QYATVPIMNNSG---CSPWYFGLVAASNICIKTTGGISTCNGDSGGPLVLDDGSNTLIGATSFGI 257
            :    ||:..|.   |:    .|...:..|....|.:.:|:|.:|..|:.:...........|||
  Fly   169 R----PIVIQSKPKMCT----NLDLYTQFCAGHQGNLRSCDGLTGSALIQNSRYMNKYRHIQFGI 225

  Fly   258 A----LGCEVGWPGVFTRITYYLDWIEEKSGVVNN 288
            |    :.||....  :|.:..:..||::...:.|:
  Fly   226 ATVNDMDCEESQG--YTDVLKFYWWIQDVVSLFNH 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 55/219 (25%)
Tryp_SPc 47..282 CDD:238113 57/222 (26%)
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 57/222 (26%)
Tryp_SPc 44..249 CDD:214473 55/219 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436301
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.