DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and CG33465

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster


Alignment Length:287 Identity:71/287 - (24%)
Similarity:103/287 - (35%) Gaps:61/287 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LATILGAQAVDWNSVKNLNIETPMPKVHG--ETLPSGRITGGQIAEPNQFPYQVGLLLYITGGAA 73
            ||.:|..:..|..:.:|:|..      ||  ||.|    ....|.:.|||               
  Fly    18 LAQLLDKKCHDPKTSENINFN------HGATETAP----WMASIYKNNQF--------------- 57

  Fly    74 WCGGTIISDRWIITAAHCTDSLTTGVDVYLGAHDRTNAKEEGQQIIFVETKNVIV---HEDWIAE 135
            .|.||::...:::|||.|. |..:.:.|..|.:   |...:..|....|...|.|   |.::...
  Fly    58 ICDGTLVHKLFVLTAASCI-SKDSQLYVLFGMY---NQYRDASQFFNNEQYGVAVALQHSNFRPN 118

  Fly   136 TITNDISLIKLPVPIEFNKYIQPAKL----PVKSDSYSTYGGENAIASGW---GKISDSATGATD 193
            ...|||.|::|...:....:|:|..:    .|||..:..:.|     .||   |..:.|....|.
  Fly   119 NGVNDIGLLRLYGEVTHYAHIRPICIILDHVVKSAPFERFEG-----FGWQQQGTEASSQVRQTV 178

  Fly   194 IL-QYATVPIMNNSGCSPWYFGLVAASNICIKTTGGISTCNGDSGGPLVLD-----DGSNTLIGA 252
            .| |........|....|...|...|.|      ...|.|..:||.||..|     ......:|.
  Fly   179 YLSQKKPFECHRNGQLLPINEGQFCAGN------RDRSFCRSNSGSPLTADFTYGVKNITVQVGL 237

  Fly   253 TSFGIALGCEVGWPGVFTRITYYLDWI 279
            .|:|..| |..  ..|:|.:..:.|||
  Fly   238 VSYGSEL-CSP--TSVYTDVVAFKDWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 58/248 (23%)
Tryp_SPc 47..282 CDD:238113 60/249 (24%)
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 61/253 (24%)
Tryp_SPc 46..261 CDD:214473 59/251 (24%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436310
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.