DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and CG6592

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster


Alignment Length:272 Identity:107/272 - (39%)
Similarity:162/272 - (59%) Gaps:13/272 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LNIE-TPMPKVHGETLPSG-----RITGGQIAEPNQFPYQVGLLLYITGGAAWCGGTIISDRWII 86
            ||:| ||:.:   :.||.|     ||.||.:..|:.||||||:||....|..||||::|||:.:|
  Fly   101 LNLETTPLME---KMLPEGAMAMDRIFGGDVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKHVI 162

  Fly    87 TAAHCTDSLTTGVDVYLGAHDRTNAKEEGQQIIFVETKNVIVHEDWIAETITNDISLIKLPVPIE 151
            |||||.|.....: |:|||::..||||:||..:.|.::|..::..|..:.:.:||::::||..:.
  Fly   163 TAAHCVDMAKRAL-VFLGANEIKNAKEKGQVRLMVPSENFQIYPTWNPKRLKDDIAIVRLPHAVS 226

  Fly   152 FNKYIQPAKLPVKSDSYSTYGGENAIASGWGKISDSATGATDILQYATVPIMNNSGCSPWYFGLV 216
            ||:.|.|.:||.:...|.::..:.|||||||:.:......:::|:|..:.|::...|...:....
  Fly   227 FNERIHPIQLPKRHYEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSNFPLSY 291

  Fly   217 AASNICIKTTGGISTCNGDSGGPLVLD---DGSNTLIGATSFGIALGCEVGWPGVFTRITYYLDW 278
            ..:|||.......|||||||||||||.   .....|:|.||||...||:.|:|..||::..||||
  Fly   292 RGTNICTSGRNARSTCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGCDRGYPAAFTKVASYLDW 356

  Fly   279 IEEKSGVVNNGD 290
            |.:::||..:.|
  Fly   357 ISDETGVSAHQD 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 94/235 (40%)
Tryp_SPc 47..282 CDD:238113 95/237 (40%)
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 94/235 (40%)
Tryp_SPc 123..359 CDD:238113 95/236 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470944
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
99.000

Return to query results.
Submit another query.