DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and CG6462

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster


Alignment Length:251 Identity:92/251 - (36%)
Similarity:145/251 - (57%) Gaps:16/251 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 RITGGQIAEPNQFPYQVGLLLYITGG-AAWCGGTIISDRWIITAAHC-TDSLT----TGVDVYLG 104
            ||.||::|....|||||||::.::|. ...|||::|:.::::||||| ||::.    ||..|:..
  Fly    76 RIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIYTGATVFAD 140

  Fly   105 AHDRTNAKEEGQQIIFVETKNVIVHEDWIAETITNDISLIKLPVPIEFNKYIQPAKLPVKSDSYS 169
            ..|   :.||.|    |..::.|::.|::.....:|::||:||..:..::.:||.:|..:....:
  Fly   141 VED---SVEELQ----VTHRDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIELAGEFMHQN 198

  Fly   170 TYGGENAIASGWGKISDSATGATDILQYATVPIMNNSGCSPWYF-GLVA-ASNICIKTTGGISTC 232
            ...|:....||||.:.||....|.:|||....:::...|..::. |||: ..::|...:.|...|
  Fly   199 FLVGKVVTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERCICYFLPGLVSQRRHLCTDGSNGRGAC 263

  Fly   233 NGDSGGPLVLD-DGSNTLIGATSFGIALGCEVGWPGVFTRITYYLDWIEEKSGVVN 287
            |||||||:|.. ...:.|||.||||.|.|||||.|.|:||||.||.||.:::.:.|
  Fly   264 NGDSGGPVVYHWRNVSYLIGVTSFGSAEGCEVGGPTVYTRITAYLPWIRQQTAMTN 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 89/241 (37%)
Tryp_SPc 47..282 CDD:238113 90/243 (37%)
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 89/241 (37%)
Tryp_SPc 77..314 CDD:238113 90/243 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.