DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and Ctrc

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001071117.1 Gene:Ctrc / 362653 RGDID:1308379 Length:268 Species:Rattus norvegicus


Alignment Length:287 Identity:102/287 - (35%)
Similarity:147/287 - (51%) Gaps:37/287 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLLLATILGAQAVDWNSVKNLNIETPMPKVHGETLPSGRITGGQIAEPNQFPYQVGLLLYITGGA 72
            :.:||.||...:...|.....|:.|             |:.||:.|.||.:|:||. |.|:... 
  Rat     4 ITVLAAILACASCCGNPAFPPNLST-------------RVVGGEDAVPNSWPWQVS-LQYLKDD- 53

  Fly    73 AW---CGGTIISDRWIITAAHCTDSLTTGVDVYLGAHDRTNAKEEGQQIIFVETKNVIVHEDWIA 134
            .|   |||::|:...::|||||.:...| ..|.||.::.|...|||.  ::.|...:.|||.|..
  Rat    54 TWRHTCGGSLITTSHVLTAAHCINKDFT-YRVGLGKYNLTVEDEEGS--VYAEVDTIYVHEKWNR 115

  Fly   135 ETITNDISLIKLPVPIEFNKYIQPAKLPVKS----DSYSTYGGENAIASGWGKISDSATGATDIL 195
            ..:.|||::|||..|:|.:..||.|.:|.:.    ..|..|      .:|||::..:...| ::|
  Rat   116 LFLWNDIAIIKLAEPVELSNTIQVACIPEEGSLLPQDYPCY------VTGWGRLWTNGPIA-EVL 173

  Fly   196 QYATVPIMNNSGCS--PWYFGLVAASNICIKTTGGISTCNGDSGGPL--VLDDGSNTLIGATSFG 256
            |....||::::.||  .|:|..|..:.:|....|.||.|||||||||  ..:|||..:.|..|||
  Rat   174 QQGLQPIVSHATCSRLDWWFIKVRKTMVCAGGDGVISACNGDSGGPLNCQAEDGSWQVHGIVSFG 238

  Fly   257 IALGCEV-GWPGVFTRITYYLDWIEEK 282
            .:.||.| ..|.||||::.|.|||.||
  Rat   239 SSSGCNVHKKPVVFTRVSAYNDWINEK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 91/244 (37%)
Tryp_SPc 47..282 CDD:238113 92/246 (37%)
CtrcNP_001071117.1 Tryp_SPc 29..262 CDD:214473 91/244 (37%)
Tryp_SPc 30..265 CDD:238113 92/246 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBU3
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.