DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and try-9

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001021891.1 Gene:try-9 / 3565941 WormBaseID:WBGene00023425 Length:279 Species:Caenorhabditis elegans


Alignment Length:256 Identity:65/256 - (25%)
Similarity:100/256 - (39%) Gaps:82/256 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GGQIAEPNQFPYQVGLLLYITGGAAWCGGTIISDRWIITAAH-----------CTD--------- 93
            ||.....|:|         :..|.    ||::|...|:||||           |..         
 Worm    15 GGNKFSENEF---------VQHGT----GTLVSPWHIVTAAHLIGISEDPLPDCDTGNLREAYFV 66

  Fly    94 ----------SLTTGV-DVYLGAHDRTNAKEEGQQIIFVETKNVIVHEDWIAETITNDISLIKLP 147
                      ::|..| ::..|.|.:...|....:.:::  :...|.:..|.....|||::.:|.
 Worm    67 RDYKNFVAFVNVTCAVPEMCKGLHRKDMFKPLAIKSLYI--RKGYVGDGCIDRESFNDIAVFELE 129

  Fly   148 VPIEFNKYIQPAKLP-------VKSDSYSTYGGENAIASGWGK-ISDSA--TGATDILQYATVPI 202
            .||||:|.|.||.||       ::...|..:        |:|: .|||.  :|....| |:.|  
 Worm   130 EPIEFSKDIFPACLPSAPKIPRIRETGYKLF--------GYGRDPSDSVLESGKLKSL-YSFV-- 183

  Fly   203 MNNSGCS---PWYFGLVAASNICIKTTGGISTCNGDSGGPLV-LDDGSN--TLIGATSFGI 257
               :.||   | |.|:...|.:    ..|:| |:||||..:| ..|..|  .|:|..|.|:
 Worm   184 ---AECSDDFP-YGGVYCTSAV----NRGLS-CDGDSGSGVVRTSDTRNVQVLVGVLSAGM 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 65/256 (25%)
Tryp_SPc 47..282 CDD:238113 65/256 (25%)
try-9NP_001021891.1 Tryp_SPc 30..237 CDD:389826 60/228 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.