DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and scaf

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster


Alignment Length:225 Identity:64/225 - (28%)
Similarity:100/225 - (44%) Gaps:38/225 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 TGGQIAEPN--QFPYQVGLLLYITGGAAWCGGTIISDRWIITAAHCTDSL-TTGVDVYLGAHDRT 109
            ||.:..:.|  :.|:| .::|..:.....|||.||.|::::::|.|.:.| .|.:.|..|..:..
  Fly   422 TGVKDLDANFAEIPWQ-AMILRESSKTLICGGAIIGDQFVLSSASCVNGLPVTDIRVKAGEWELG 485

  Fly   110 NAKEEGQQIIFVET--KNVIVHEDWIAETITNDISLIKLPVPIEFNKYIQPAKLPVKSDSYSTYG 172
            :..|   .:.|..|  |.|.||.|:...|.::|:::|:|...:||..:|||..:..:....|   
  Fly   486 STNE---PLPFQLTGVKTVDVHPDYDPSTNSHDLAIIRLERRLEFASHIQPICISDEDPKDS--- 544

  Fly   173 GENAIASGWGK--ISDSATGA----TDILQYATVPIMNNSGCSPWYFGLVAASNICIKTTGGIST 231
             |....|||||  :|....||    ||.|..|      .|.||      ..:|::|..|.  ..:
  Fly   545 -EQCFTSGWGKQALSIHEEGALMHVTDTLPQA------RSECS------ADSSSVCSATK--FDS 594

  Fly   232 CNGDSGGPLVLDDGSNTLI-----GATSFG 256
            |..|.|..|....||:..:     |..|.|
  Fly   595 CQFDVGSALACGSGSSVRLKGIFAGENSCG 624

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 64/225 (28%)
Tryp_SPc 47..282 CDD:238113 64/225 (28%)
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 59/209 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435403
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.