DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and CG4650

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:275 Identity:70/275 - (25%)
Similarity:111/275 - (40%) Gaps:63/275 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 GRITGGQIAEPNQFPYQVGL----LLYITGGAAWCGGTIISDRWIITAAHCT---DSLTTGVDVY 102
            |.:|.|:||.....|:...|    |||:      ||||:|:::.::||||||   :.|...:..:
  Fly    29 GLLTNGKIANNISSPWMAYLHTSELLYV------CGGTVITEKLVLTAAHCTRASEQLVARIGEF 87

  Fly   103 LGAHDRTNAKEEGQQIIFVETKNVIVHEDWIAETITNDISLIKLPVPIEFNKYIQPAKLPVKSDS 167
            :|..|..:......|:     ....:|..:...|..|||:::.|...|.|:|.|:|..: |....
  Fly    88 IGTDDANDTMLSEYQV-----SQTFIHSLYNTTTSANDIAILGLATDIVFSKTIRPICI-VWWTI 146

  Fly   168 YSTYGGENAIASG--WGKISD----SATGATDILQYATVPIMNNSGCSPWYFGLVAASNIC--IK 224
            :..|.....:.||  ||..:|    .|...|||.:                    ..:|:|  :.
  Fly   147 WRKYIDNIQVLSGAQWGLPNDRNESDAFRITDIRR--------------------QPANMCSTLN 191

  Fly   225 TTGGIST--CNGDSGGPLVLDDGSNTLIGATSF---------GIAL---GCEVGWPGVFTRITYY 275
            .|..:|:  |.|||...|...|.|:.|....:|         |||.   .|:..  .|:|.:..:
  Fly   192 GTAILSSQFCAGDSDSKLCNVDFSSPLGAIITFKNIQRYVLIGIATTNQKCKRA--SVYTDVLSH 254

  Fly   276 LDWIEEKSGVVNNGD 290
            .|:|........||:
  Fly   255 TDFILSVWRQYRNGE 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 66/261 (25%)
Tryp_SPc 47..282 CDD:238113 67/263 (25%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 65/258 (25%)
Tryp_SPc 33..258 CDD:304450 65/258 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436298
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.