DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and PRSS48

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:XP_011530223.1 Gene:PRSS48 / 345062 HGNCID:24635 Length:351 Species:Homo sapiens


Alignment Length:290 Identity:87/290 - (30%)
Similarity:135/290 - (46%) Gaps:50/290 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SVKNLNIETPMPKVHGETLPSGRITGGQIAEPNQFPYQVGLLL---YITGGAAWCGGTIISDRWI 85
            |:.:|::      |.|:.:.|.|:.|||.|...::|:||.|..   :|      |||:::|:|.|
Human    34 SLSSLSL------VCGQPVYSSRVVGGQDAAAGRWPWQVSLHFDHNFI------CGGSLVSERLI 86

  Fly    86 ITAAHCTDS--LTTGVDVYLGAHDRTNAKEEGQQIIFVETKNVIVHEDWIAETITNDISLIKLPV 148
            :|||||...  .|....|:||:   ....:..:::.:..:| :::|..:  :..|.|::|:||..
Human    87 LTAAHCIQPTWTTFSYTVWLGS---ITVGDSRKRVKYYVSK-IVIHPKY--QDTTADVALLKLSS 145

  Fly   149 PIEFNKYIQPAKLPVKSDSYSTYGGENAI-----ASGWGKISDSA-TGATDILQYATVPIMNNSG 207
            .:.|...|.|..||       :...:.||     .:||||:.:|: ......||.|.|||::...
Human   146 QVTFTSAILPICLP-------SVTKQLAIPPFCWVTGWGKVKESSDRDYHSALQEAEVPIIDRQA 203

  Fly   208 CSPWY--FGL--------VAASNICIKTTGGI-STCNGDSGGPLVLD-DGSNTLIGATSFGIALG 260
            |...|  .|:        :....||...|..: .:|.|||||||... ||.....|..|:|  |.
Human   204 CEQLYNPIGIFLPALEPVIKEDKICAGDTQNMKDSCKGDSGGPLSCHIDGVWIQTGVVSWG--LE 266

  Fly   261 CEVGWPGVFTRITYYLDWIEEKSGVVNNGD 290
            |....|||:|.:.||..||.......||.|
Human   267 CGKSLPGVYTNVIYYQKWINATISRANNLD 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 77/255 (30%)
Tryp_SPc 47..282 CDD:238113 78/257 (30%)
PRSS48XP_011530223.1 Tryp_SPc 50..285 CDD:214473 77/255 (30%)
Tryp_SPc 51..288 CDD:238113 78/257 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.