DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and ela2l

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_956180.1 Gene:ela2l / 334304 ZFINID:ZDB-GENE-040511-1 Length:267 Species:Danio rerio


Alignment Length:289 Identity:100/289 - (34%)
Similarity:144/289 - (49%) Gaps:36/289 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFACATVLLLATILGAQAVDWNSVKNLNIETPMPKVHGETLPSGRITGGQIAEPNQFPYQVGLL 65
            |||    |:|...::||.        :..:.|..|.|       .|:.||....||.:|:|:.  
Zfish     2 MKF----VVLAVLVVGAY--------SCGLPTFPPIV-------TRVVGGVDVRPNSWPWQIS-- 45

  Fly    66 LYITGGAAW---CGGTIISDRWIITAAHCTDSLTTGVDVYLGAHDRTNAKEEGQQIIFVETKNVI 127
            |....|:.|   |||::|..:|::|||||..|..| ..|:||.|. .:.:|.|.  :.:....:|
Zfish    46 LQYKSGSNWYHTCGGSLIDKQWVLTAAHCISSSRT-YRVFLGKHS-LSQEENGS--VAIGAGKII 106

  Fly   128 VHEDWIAETITNDISLIKLPVPIEFNKYIQPAKLPVKSDSYSTYGGENAIASGWGKISDSATGAT 192
            |||.|.:.||.|||:||||...:.....|.||.||  ...|..........:|||::..:...| 
Zfish   107 VHEAWNSFTIRNDIALIKLETAVTIGDTITPACLP--EAGYVLPHNAPCYVTGWGRLYTNGPLA- 168

  Fly   193 DILQYATVPIMNNSGC--SPWYFGLVAASNICIKTTGGISTCNGDSGGPL--VLDDGSNTLIGAT 253
            ||||.|.:|:::::.|  |.|:...|..|.:|....|.::.|:|||||||  ...||:..:.|..
Zfish   169 DILQQALLPVVDHATCSKSDWWGSQVTTSMVCAGGDGVVAGCDGDSGGPLNCAGSDGAWEVHGIV 233

  Fly   254 SFGIALGCEVG-WPGVFTRITYYLDWIEE 281
            |||..|.|... .|.||||::.|.|||.:
Zfish   234 SFGSGLSCNYNKKPTVFTRVSAYSDWISK 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 88/240 (37%)
Tryp_SPc 47..282 CDD:238113 89/243 (37%)
ela2lNP_956180.1 Tryp_SPc 28..260 CDD:214473 88/240 (37%)
Tryp_SPc 29..263 CDD:238113 89/243 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.