DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and psh

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster


Alignment Length:258 Identity:77/258 - (29%)
Similarity:128/258 - (49%) Gaps:31/258 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 ITGGQIAEPNQFPYQVGLLLYITGGAAW-CGGTIISDRWIITAAHC--TDSLTTGVDVYLGAHDR 108
            |.||...:|..:|: :..:.|||.|..: |||::|:.|:::|||||  ||: .|...|.|||.:.
  Fly   144 IVGGYPVDPGVYPH-MAAIGYITFGTDFRCGGSLIASRFVLTAAHCVNTDA-NTPAFVRLGAVNI 206

  Fly   109 TNAKEEGQQIIFVETKNVIVHEDWIAETITNDISLIKLPVPIEFNKYIQPAKLPVKSDSYSTYGG 173
            .|.....|.|:.   ::|.:|..::.... |||::::|...:.....|:||.|  .:|:......
  Fly   207 ENPDHSYQDIVI---RSVKIHPQYVGNKY-NDIAILELERDVVETDNIRPACL--HTDATDPPSN 265

  Fly   174 ENAIASGWGKISDSATGATDILQYATVPIMNNSGCSPWYF-----------GLVAASNICIKTTG 227
            .....:|||.::.:....:.||..|.:.::....|:..|.           |::.:....|....
  Fly   266 SKFFVAGWGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVIDSLLCAIDQKL 330

  Fly   228 GISTCNGDSGGPLV----LDDGSNTLIGATSFGIALGCEVGWPGVFTRITYYLDWIEEKSGVV 286
            ....|.|||||||:    ::||..|::|..|.|  .||....||::||::.|||:||   |:|
  Fly   331 IADACKGDSGGPLIHELNVEDGMYTIMGVISSG--FGCATVTPGLYTRVSSYLDFIE---GIV 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 73/249 (29%)
Tryp_SPc 47..282 CDD:238113 75/252 (30%)
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 73/249 (29%)
Tryp_SPc 144..387 CDD:238113 75/255 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437041
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.