DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10472 and sphe

DIOPT Version :9

Sequence 1:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:275 Identity:76/275 - (27%)
Similarity:120/275 - (43%) Gaps:34/275 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLATILGAQAVDWNSVKNLNIETPMPKVHGETLPSGRITGGQIAEPNQFPYQVGLLLYITGGAA 73
            |::..::|..||                  |.....|||.||:.|:.....:...|.:   ..|.
  Fly     6 LVILGLIGLTAV------------------GMCHAQGRIMGGEDADATATTFTASLRV---DNAH 49

  Fly    74 WCGGTIISDRWIITAAHCTDSLTTGVDV-YLGAHDRTNAKEEGQQIIFVETKNVIVHEDWIAETI 137
            .|||:|:|...|:|.|||.......:|. .|.....:..:..|.:|:.||  :|.||.|:.  .:
  Fly    50 VCGGSILSQTKILTTAHCVHRDGKLIDASRLACRVGSTNQYAGGKIVNVE--SVAVHPDYY--NL 110

  Fly   138 TNDISLIKLPVPIEFNKYIQPAKLPVKSDSYSTYGGENAIASGWGKISDSATGATDILQYATVPI 202
            .|::::|.|...:.:...|....|....::....|.| .|.:|||:.|| .|.:..|.| .::.:
  Fly   111 NNNLAVITLSSELTYTDRITAIPLVASGEALPAEGSE-VIVAGWGRTSD-GTNSYKIRQ-ISLKV 172

  Fly   203 MNNSGCSPWYFGLVAASNICIKTTGGISTCNGDSGGPLVLDDGSNTLIGATSFGIALGCEVGWPG 267
            ...:.|...|......| .|:.......||:||.||..:.   .|||||.|:|.:. .|...:|.
  Fly   173 APEATCLDAYSDHDEQS-FCLAHELKEGTCHGDGGGGAIY---GNTLIGLTNFVVG-ACGSRYPD 232

  Fly   268 VFTRITYYLDWIEEK 282
            ||.|::.|.|||:|:
  Fly   233 VFVRLSSYADWIQEQ 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 67/233 (29%)
Tryp_SPc 47..282 CDD:238113 68/235 (29%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 64/219 (29%)
Tryp_SPc 42..244 CDD:214473 62/216 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471058
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.